PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG253200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 319aa    MW: 33851.4 Da    PI: 7.8079
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG253200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.3e-4174150278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC++dls+++eyhrrh+vCe+hsk+pvv+v g+eqrfCqqCsrfh+lsefDe+krsCr+rL++hn+rrrk+q+
  Pavir.8NG253200.1.p  74 CSVDGCRSDLSRCREYHRRHRVCEAHSKTPVVVVGGQEQRFCQQCSRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQH 150
                          **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3368135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.44571148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-3973152IPR004333Transcription factor, SBP-box
PfamPF031106.7E-3174147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDWAAASGAP SWGTAAADPG PTMLSFAGPS SSSDAAAEAR LHDFAAGLAQ SARPAGAAGA  60
GRRSRSAGGG TEACSVDGCR SDLSRCREYH RRHRVCEAHS KTPVVVVGGQ EQRFCQQCSR  120
FHMLSEFDEG KRSCRKRLDG HNRRRRKPQH DLANLGGFFP YHQVNQFEMY PRTIPTACQD  180
SDDMSLVDPQ PPFSISFSRT PKQFPFPHDG GSLLSASRHG HFLVQDGNHT GSSACSHDLS  240
GTLGPECALS LLSSSLHHPS PAGHAQVASA LSRIASTSQQ VAATPVTTAF ASGGSHHVFV  300
PDAALEDPSQ ALPFPWQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2766147384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130147KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.8NG253200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826748.11e-166putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y19e-91SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A3L6PNI81e-175A0A3L6PNI8_PANMI; Putative squamosa promoter-binding-like protein 19
STRINGPavir.Hb01173.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-41SBP family protein