PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG359700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 420aa    MW: 46080.9 Da    PI: 6.6535
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG359700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.71.1e-211053245
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                         + en+s rqvt+skRr gilKKA+ELS+LCd++  +++fs++gk
  Pavir.8KG359700.1.p 10 KLENSSGRQVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGK 53
                         679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.656153IPR002100Transcription factor, MADS-box
SMARTSM004325.2E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-17323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-191155IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQVT YSKRRSGILK KAKELSILCD IDLILLMFSP SGKPTVCIGE  60
KSNIEEVIAK YAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSSH  120
IGSLQCQMAD VQKRLSYWGD PEKIENIDHI RGMEQSLKES LNRIRIHKVG IPSLLVNFLT  180
SLSMYDISSI NVSQENFAKQ HLIGLQCAAA QFQTDMQLPL GLTGDPGPSS WFQNGGADGQ  240
QTMMLPDDSG LLHQRDIGCS TSTSLQSYPG YFSMSKQSTD TGGGSEHGQP AVHQQPPDFG  300
QAECLTHLGA QFPYTPFDTS LFNERMFRPD AMELHDGSAG IDFGGGHFGM PRPGDEASFQ  360
NWASAACGAA MFDHHQQQQH HQQQQPSSAQ IPAATTLAPA SFDHAAVKQD PSQHQQVMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-13192190MEF2 CHIMERA
6byy_B2e-13192190MEF2 CHIMERA
6byy_C2e-13192190MEF2 CHIMERA
6byy_D2e-13192190MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.8KG359700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828481.10.0agamous-like MADS-box protein AGL65
TrEMBLA0A2T7CQU50.0A0A2T7CQU5_9POAL; Uncharacterized protein
STRINGPavir.J04162.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.15e-73AGAMOUS-like 65