PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG337000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 535aa    MW: 61237.1 Da    PI: 6.7829
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG337000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS36.75.9e-121972942117
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+a++++++  a +lL++++++as +gd +qR+a+ + + L a  ++                   +e l+a++l++ ++ + 
  Pavir.8KG337000.1.p 197 RTLLISCAQAMATNNHMGACELLKKIKKHASATGDVTQRVAHQLWQLLMAERLS------------------IVEFLKAYRLYFAACCFN 268
                          789***************************************988776554444..................7999************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDf 117
                          k++      +I  a+ g++++H++D+
  Pavir.8KG337000.1.p 269 KVALSFSTMTIFHAMVGKRKLHVVDY 294
                          *************************7 PP

2GRAS173.51.7e-53306526154373
                 GRAS 154 skeeleetgerLakfAeelgv.pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvv 240
                           +e++ee+g rL+k A+e+g+ +f+f++ ++k++ed+++e+L+++ +E+l+Vn  ++  +l+desv  +   +rd+vL+ +++++P+v++
  Pavir.8KG337000.1.p 306 PAERIEELGCRLSKCAHEFGLaSFKFHT-IMKKWEDVRIEDLNTDADEVLVVNDLFSFNTLMDESVFFDRqsPRDTVLNNINKMRPDVFI 394
                          6899****************957*****.7***********************************96554449***************** PP

                 GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                           +  ++++ ++sFl+rf e ++yy a+fd+l+a+ prese r+++E+++lgr + n++aceg + +er e++++W+ r ++aG++++pl+
  Pavir.8KG337000.1.p 395 QSVLNCSC-GSSFLTRFREVMSYYIAIFDMLDATTPRESESRVVLEQFVLGRPALNIIACEGPDLVERPEKYRQWQVRNQRAGLRQLPLK 483
                          *******9.679****************************************************************************** PP

                 GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          +++++ +k  +rk++ + + + e+ ++l++gW++r L++ S W
  Pavir.8KG337000.1.p 484 SRIVEAVKDTVRKHHHKDFLICEDGQWLLQGWMGRVLFAHSTW 526
                          ***************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.64170507IPR005202Transcription factor GRAS
PfamPF035142.0E-9197294IPR005202Transcription factor GRAS
PfamPF035145.7E-51306526IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MMLPYISHML LEDDIDDNEL NDHPALLQVQ QPFAQILSSS SYGANTSNTD SAKDLLQDGW  60
DDDSTLNLNS ALSKGTDAIR AFLKGMEEAN MLLLKDTKQF RGGVQMLRES NNHTGDKKRN  120
DRDNHMEEQI RTSKAAKRIN DPEENCANEM LDELMLRAYE TCIKGMEELR VSMDNKMEKE  180
NRKKFNKAVK DNVVDIRTLL ISCAQAMATN NHMGACELLK KIKKHASATG DVTQRVAHQL  240
WQLLMAERLS IVEFLKAYRL YFAACCFNKV ALSFSTMTIF HAMVGKRKLH VVDYVEKAPP  300
KLKSCPAERI EELGCRLSKC AHEFGLASFK FHTIMKKWED VRIEDLNTDA DEVLVVNDLF  360
SFNTLMDESV FFDRQSPRDT VLNNINKMRP DVFIQSVLNC SCGSSFLTRF REVMSYYIAI  420
FDMLDATTPR ESESRVVLEQ FVLGRPALNI IACEGPDLVE RPEKYRQWQV RNQRAGLRQL  480
PLKSRIVEAV KDTVRKHHHK DFLICEDGQW LLQGWMGRVL FAHSTWVAQD TSSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YCU60.0K3YCU6_SETIT; Uncharacterized protein
STRINGSi012046m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.13e-87GRAS family protein