PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG299600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 659aa    MW: 73311.8 Da    PI: 5.1407
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG299600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.73.3e-1022826522373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+av++++ + a +lL ++++++sp+gd++qRla++f+e+L+arla+s+s+ly++  +++ +   ++e l+a  l+  ++ + 
  Pavir.8KG299600.1.p 282 STLLIHCAQAVATDNRRSAAELLRQIRQHSSPRGDATQRLAHVFAEGLEARLAGSGSQLYASTVAERVP---VTEYLKACWLYLAACCFE 368
                          579*********************************************************988888888...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                           +++     aI +a++g +++Hi+D+++s+G+QWp+Ll+ La+R++gpp++RiTg++ p++g   + ++e+tg+rL++ A+++gv f+f+
  Pavir.8KG299600.1.p 369 MVAFKFSIAAICNAAAGRKKLHIVDYGVSYGFQWPSLLRCLANREGGPPEVRITGIDLPQPGfrPAAQIEATGRRLSNCARQFGVAFKFR 458
                          *************************************************************9*9************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            +a ++e++  ++L+++++E+l+Vn+v   ++l+de ++++s  +rd vL  +++++P+++++   ++  +++ Fl+rf eal yysa+
  Pavir.8KG299600.1.p 459 G-IAAKWETIGADDLDIDRDEVLIVNSVR-FQNLMDEGADIDSpsPRDIVLGNIRKMRPDMFILFTTNVLSGASFFLTRFREALFYYSAM 546
                          *.799*********************997.8999999999988779******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd+l+a++pr+s++r  vEr l+++ + n+vaceg++r+er et+++W++r ++aG+k++pl+ +++ +++ ++r+ + + + ++ ++++
  Pavir.8KG299600.1.p 547 FDMLDATAPRDSHQRLLVERGLFRPCALNAVACEGSDRVERPETYKQWQARSQRAGLKQLPLDPDIVRDVREMVREQYHKDFAIDVDHHW 636
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l+ gWk+r L+++S W
  Pavir.8KG299600.1.p 637 LLEGWKGRVLYAMSTW 652
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.826255633IPR005202Transcription factor GRAS
PfamPF035141.1E-99282652IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MAEGEGLFAD PEPFSPSVFL DLPPTPHPDG TEDPVSSDDL ILPFISRMLM EEDIGDQFFY  60
QYPEHPALLQ AQQPFADILS DAATNSTSSG STATLSPSSP DDPIQLPHLL QPAPHATAGL  120
EQHDGVHSWA LLDDADEEGR RKKSSDGDQD QTVLASAFFS GNNRDILNQA FLKGKEEANR  180
FLPTNSTLGG GRKKTHNWDD YDDLEAETCR KSKLMVPEPE ETGEAVDEMI VNAYDLCLKE  240
MESLRITMGT SEDPKKKKEK KKKGMKGKGK GSRSRNEAVD LSTLLIHCAQ AVATDNRRSA  300
AELLRQIRQH SSPRGDATQR LAHVFAEGLE ARLAGSGSQL YASTVAERVP VTEYLKACWL  360
YLAACCFEMV AFKFSIAAIC NAAAGRKKLH IVDYGVSYGF QWPSLLRCLA NREGGPPEVR  420
ITGIDLPQPG FRPAAQIEAT GRRLSNCARQ FGVAFKFRGI AAKWETIGAD DLDIDRDEVL  480
IVNSVRFQNL MDEGADIDSP SPRDIVLGNI RKMRPDMFIL FTTNVLSGAS FFLTRFREAL  540
FYYSAMFDML DATAPRDSHQ RLLVERGLFR PCALNAVACE GSDRVERPET YKQWQARSQR  600
AGLKQLPLDP DIVRDVREMV REQYHKDFAI DVDHHWLLEG WKGRVLYAMS TWVADDAM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-422856528374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001183419.10.0uncharacterized protein LOC100501842
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC4J6B20.0C4J6B2_MAIZE; Uncharacterized protein
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
STRINGGRMZM2G073779_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein