PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG244600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 505aa    MW: 54733.1 Da    PI: 7.1224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG244600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2707.9e-8312849314373
                 GRAS  14 sgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIl 103
                          ++d + a++lL +++++asp+gd++qRla++++ AL+arla+ ++++++  pp  t+  + +e l+a++lf+ ++ + k+++  aNq+I 
  Pavir.8KG244600.1.p 128 DDDRRGARELLRQVKQHASPTGDATQRLAHCLAAALEARLAGAGTGTASPPPPLMTAAASRAEFLNAYRLFVATCSFEKVAFTFANQTIR 217
                          678999**************************************************9999****************************** PP

                 GRAS 104 eavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                          +a++g+ r+H++D+++  GlQWp Ll+ La    gpp++ iT v+ p+ g   + ++eetg+ L+ +A+ +gvpf+ ++++a r++++  
  Pavir.8KG244600.1.p 218 RAAAGSPRLHVVDYGLHLGLQWPGLLRRLAG--CGPPEVIITFVDLPQLGfrPASRIEETGRSLSAYARGIGVPFKSHAVAAARWDAIGA 305
                          ******************************8..6**************9999***************************9999******* PP

                 GRAS 192 eeLrvkp...gEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                          ++L +     g +++Vn+ ++l++l d+sv ++    +rd+vL  +++++P v+++   +    ++sF +rf +al y+sa+fd lea++
  Pavir.8KG244600.1.p 306 DQLGIAVddpGAVVVVNSLFKLETLADDSVVVDGgpsPRDRVLASIRGMRPSVFTHGVVNGFA-GNSFPTRFRKALFYFSAVFDVLEATM 394
                          ***887666799******************99877779*****************99988766.789*********************** PP

                 GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkd 364
                          pr+se r+++Er +lg+ + nvvaceg++r+ r  ++++W+ r ++aG++++pl+ +++ +++  + k++  + + + e++g+l++gWk+
  Pavir.8KG244600.1.p 395 PRASERRRVLERDVLGPCALNVVACEGRHRTDRFDSYRQWQLRSRRAGLRQLPLDREVVGEVRDEVGKHGyHRDFVISEDHGWLLQGWKG 484
                          **********************************************************************9999**************** PP

                 GRAS 365 rpLvsvSaW 373
                          r L++   W
  Pavir.8KG244600.1.p 485 RILYAHANW 493
                          *****9999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.41689473IPR005202Transcription factor GRAS
PfamPF035142.7E-80128493IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MEAAGAQHRV RISSTDLLNM AFLRGREEAS KLLPRDDRLV ISPEPHHMEI TGRASKLMAM  60
AAPADDEMVA RMTASDCELP KEEMEHLRAA MADEAAGQGC VAAAEEDEAA AAAAGGHAHA  120
AGPLRVVDDD RRGARELLRQ VKQHASPTGD ATQRLAHCLA AALEARLAGA GTGTASPPPP  180
LMTAAASRAE FLNAYRLFVA TCSFEKVAFT FANQTIRRAA AGSPRLHVVD YGLHLGLQWP  240
GLLRRLAGCG PPEVIITFVD LPQLGFRPAS RIEETGRSLS AYARGIGVPF KSHAVAAARW  300
DAIGADQLGI AVDDPGAVVV VNSLFKLETL ADDSVVVDGG PSPRDRVLAS IRGMRPSVFT  360
HGVVNGFAGN SFPTRFRKAL FYFSAVFDVL EATMPRASER RRVLERDVLG PCALNVVACE  420
GRHRTDRFDS YRQWQLRSRR AGLRQLPLDR EVVGEVRDEV GKHGYHRDFV ISEDHGWLLQ  480
GWKGRILYAH ANWVADDDDD ASRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-2713849326374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450074.10.0hypothetical protein SORBIDRAFT_05g027800
TrEMBLC5Y1S80.0C5Y1S8_SORBI; Putative uncharacterized protein Sb05g027800
STRINGSb05g027800.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-92GRAS family protein