PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG244500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 576aa    MW: 65269.9 Da    PI: 7.3194
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG244500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.37.6e-911985673373
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+a+++g+   aq+lL++++++as++gd +qRla++f ++L+arla+++s+l + l+++      ++e l+a+k++  ++ + +
  Pavir.8KG244500.1.p 198 TLLIRCAQAMAAGSVMTAQELLKQIKQNASSTGDDTQRLAQCFSKGLEARLAGTGSQLWQLLTAEGPL---VIEYLQAYKFYLAACCFNR 284
                          79***************************************************999999988887776...******************* PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          ++ +    +I  a++g++++Hi+D++  +G+QW+ Ll+ +a+R++gpp+++iT++++ ++    +e +e tg+rL k A+e+gvpf+f+ 
  Pavir.8KG244500.1.p 285 VALFFNIMTIEHAMAGKSKLHIVDYGPHHGFQWAGLLRWMANREGGPPEVKITAISRLQPRscPSEGIEDTGHRLGKCAREFGVPFKFHS 374
                          *********************************************************9999999************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                           ++ r+e++ +++L+++ +E+l+V   ++   l+des   ++  +rd+vL+ +++++P+v++    ++++ ++sFl+rf eal yysalf
  Pavir.8KG244500.1.p 375 -ITARWETICTDNLKTDADEVLVVIDLFNFSILMDESIYFDNpsPRDTVLNNIRKMRPDVFIQGVVNSSY-GTSFLARFREALFYYSALF 462
                          .699*********************************98877779**********************999.679**************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+l+a++pre + r+++E+ +lg ++ nv+aceg + ++r e++++W+ r ++aG++++pl+ +++k  k  + k + + + v e+ ++l
  Pavir.8KG244500.1.p 463 DMLDATIPRECKLRSVLEQGMLGHSVLNVIACEGVDLVNRPEKYRQWQVRNQRAGLRQLPLKPNIVKVLKEKVMKDHHRDFFVGEDGQWL 552
                          ***********************************************************************999999888********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L++ S W
  Pavir.8KG244500.1.p 553 LQGWKGRILYAHSTW 567
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.71170548IPR005202Transcription factor GRAS
PfamPF035142.6E-88198567IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MVLSYISRFL MEDDTEDKIL RGNSDHPALL QVQEPFAQIL FSPSISANSD NTTHKCNMEG  60
ANNLLQGRNG NQCTLSSAFS KGEDAAGAFL KSIEEASRFL PKDNGIRKDQ LVNQECVNHR  120
VIKKRYNRDE HHEREVCRAS KAMMMMEELE EMFDKMMLRG YETCIKDMEK LRSAKADEAM  180
NDKKSGSKMR TDVVDLCTLL IRCAQAMAAG SVMTAQELLK QIKQNASSTG DDTQRLAQCF  240
SKGLEARLAG TGSQLWQLLT AEGPLVIEYL QAYKFYLAAC CFNRVALFFN IMTIEHAMAG  300
KSKLHIVDYG PHHGFQWAGL LRWMANREGG PPEVKITAIS RLQPRSCPSE GIEDTGHRLG  360
KCAREFGVPF KFHSITARWE TICTDNLKTD ADEVLVVIDL FNFSILMDES IYFDNPSPRD  420
TVLNNIRKMR PDVFIQGVVN SSYGTSFLAR FREALFYYSA LFDMLDATIP RECKLRSVLE  480
QGMLGHSVLN VIACEGVDLV NRPEKYRQWQ VRNQRAGLRQ LPLKPNIVKV LKEKVMKDHH  540
RDFFVGEDGQ WLLQGWKGRI LYAHSTWVAE DAISE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-272005678374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.310180.0callus
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450073.10.0hypothetical protein SORBIDRAFT_05g027795, partial
TrEMBLC5Y1S70.0C5Y1S7_SORBI; Putative uncharacterized protein Sb05g027795 (Fragment)
STRINGSb05g027795.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-113GRAS family protein