PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG244400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 623aa    MW: 70114.5 Da    PI: 6.9927
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG244400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS271.33.1e-832436141373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+av+++++ +a++lL++++++as +gd++qRla++f+++L+arl++++s+l + l +++ s   + e l+a+kl+  +  +
  Pavir.8KG244400.1.p 243 LRTLLVLCAQAVAANNHMCAHELLKQIKKHASASGDATQRLAQCFAKGLEARLLGTGSHLWQLLITERPS---VMEFLQAYKLYLAAGSF 329
                          5789*********************************************************999888887...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +k++       ++ a+ g++++Hi+D++   G++ + Ll+ LasR++gpp++++T++g ++     +e++e +g  L+k A+e+g+pf+f
  Pavir.8KG244400.1.p 330 IKVAVTYLIMIVMHAMIGKSKLHIVDYGPRFGFHLAGLLRVLASREGGPPEVKVTAIGCSNLRscPTERTEDIGMLLSKCAREFGLPFKF 419
                          *********************************************************997766889************************ PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          ++ ++ + e++ +e+L+++ +E+l+Vn  ++  +l+desv  ++  +rd vL+ +++++P+v++ +  + ++ ++sFl rf  al yy+a
  Pavir.8KG244400.1.p 420 HA-IMMKSEKVCIEDLKTNDDEVLVVNDLFNFSTLMDESVFFDHpsPRDIVLNNIRNMRPNVFIQSIVNYSC-GSSFLSRFRGALFYYTA 507
                          **.688899999***************************97776669*****************99999999.679************** PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          lfd+l+a++pre++ r+ +E+ +lg  + n++aceg +     e++++W+ r ++aG++++pl+ +++k+ k  +++ + +++ + e+ +
  Pavir.8KG244400.1.p 508 LFDMLDATIPRENQLRVLLEQGFLGHGALNAIACEGVDLMDHPEKYKQWQVRNQRAGLRQLPLKPHIVKELKEKVKQNYHNEFLISEDGQ 597
                          *******************************************************************************999******** PP

                 GRAS 357 slvlgWkdrpLvsvSaW 373
                          +l++gW ++ L++ S W
  Pavir.8KG244400.1.p 598 WLLQGWTGHVLFAHSTW 614
                          ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.85217595IPR005202Transcription factor GRAS
PfamPF035141.1E-80243614IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MATTPEEFFA KGLMDPSPPS PAVSLDFPLM PEGCQGPFSP DETVLSYVSV MLMEEDTDEK  60
LYQYSDHPAL VQVQQSFAQI LSPPSSRVDH DNKSRGGMDG IKDLFQNNNG HQSTLDPAFS  120
KGVDAVGAFL RGMEEARMFL PNDNSSRRDE LVNCMSRESS SHCGVKKRYN RDKHQDEVSR  180
ASKAVKMMEQ EEIGVHKMFN EMMFHSYEVC ITSMDNLRIS MATESKKNNR KSISNKTRDV  240
VDLRTLLVLC AQAVAANNHM CAHELLKQIK KHASASGDAT QRLAQCFAKG LEARLLGTGS  300
HLWQLLITER PSVMEFLQAY KLYLAAGSFI KVAVTYLIMI VMHAMIGKSK LHIVDYGPRF  360
GFHLAGLLRV LASREGGPPE VKVTAIGCSN LRSCPTERTE DIGMLLSKCA REFGLPFKFH  420
AIMMKSEKVC IEDLKTNDDE VLVVNDLFNF STLMDESVFF DHPSPRDIVL NNIRNMRPNV  480
FIQSIVNYSC GSSFLSRFRG ALFYYTALFD MLDATIPREN QLRVLLEQGF LGHGALNAIA  540
CEGVDLMDHP EKYKQWQVRN QRAGLRQLPL KPHIVKELKE KVKQNYHNEF LISEDGQWLL  600
QGWTGHVLFA HSTWVAEDVP SK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-242476148374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.13e-99GRAS family protein