PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG243400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 923aa    MW: 101777 Da    PI: 6.2812
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG243400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS186.51.8e-5720342511233
                 GRAS  11 avssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                          av+++d + a+ lLa+++ ++sp+gd+ qRla++f+e+L+arla+++s+ly++l +++ts    ++ l+a++lf  ++ + k+++   N+
  Pavir.8KG243400.1.p 203 AVAADDRRGAHDLLAQVRRHSSPTGDAAQRLAHCFAEGLEARLAGTGSRLYRSLMVRPTS---AVDFLKAYQLFLAACCCKKVAFTFSNK 289
                          899********************************************************9...9************************** PP

                 GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                          +  +a++g +r+Hi+D++i++G+QWp Ll+ La+R +gpp++RiTg++ p++g   + ++eetg+rLa  A+elgvpf+f+  ++ r e+
  Pavir.8KG243400.1.p 290 TFSDAAAGRRRLHIVDYGIGYGFQWPGLLRGLAARHGGPPEVRITGIDLPQPGfrPAYQIEETGRRLATCARELGVPFRFRG-ITARRET 378
                          ****************************************************99999*************************.69999** PP

                 GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvks 233
                          +++e+L+++pgE+l+V    +  +l+desv +    +rdevL  +++
  Pavir.8KG243400.1.p 379 VSPEDLELDPGEVLVVIGLCHFRHLMDESVVVGRpsPRDEVLGNIRR 425
                          *****************************98766559******9986 PP

2GRAS259.71e-795789212355
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cA+av + d + a +lL++++++asp+gd+ qRla +f+++L+arla+++s++y++l++ +++     e l+a++lf  ++ + 
  Pavir.8KG243400.1.p 578 HTLLLHCAKAVID-DRRSAGELLKQIKDHASPTGDAAQRLAYCFAQGLEARLAGTGSQVYRSLTADRAP---LLEFLKAYQLFMSTCCFR 663
                          679********97.8999*********************************************999999...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+++  aN+aI +a+ g +++Hi+D+++  G+QW  Ll+ L +R++gp ++RiT ++ p++g   ++ + e+g+rL++ A+++ vp++f 
  Pavir.8KG243400.1.p 664 KVAFDFANKAIFDAAIGRSKLHIVDYGLHSGFQWSELLRLLGARDGGPSEVRITSIDLPQPGfrPANHIAEMGHRLSNCARQFCVPLKFC 753
                          *************************************************************9*9************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + v+ +++++ +++L+v+p+E+l+V+  l+  +l+d sv ++       +  k+++P+v+v    + ++ ++ Fl  f eal y+sa+fd
  Pavir.8KG243400.1.p 754 A-VVAQWHTICIDDLNVEPDEVLVVSDLLNFRTLMDVSVVIDR------SSPKDMKPDVFVQGIINGSY-GTFFLSWFREALFYHSAMFD 835
                          *.7999*****************************99999999......999*****************.789***************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                          +l+a++pres+ r ++Er ++g+ + n++aceg++r+er et+++W+ r ++aG++++pl+ + ++ ++ ++++ + + + +ee++
  Pavir.8KG243400.1.p 836 MLDATMPRESRLRLVLERGIFGWVALNAIACEGEDRVERGETYKQWQIRNRRAGLRQLPLNRDSVNMVRNMVKNQYHKDFVIEEDQ 921
                          ****************************************************************************888****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.802167416IPR005202Transcription factor GRAS
PfamPF035146.2E-55203425IPR005202Transcription factor GRAS
PROSITE profilePS5098552.099551920IPR005202Transcription factor GRAS
PfamPF035143.6E-77578921IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    Send to blast
MAAAPEEFLF VHPDPPSPSV FLDLPPTPPH DDDMALPYIA RLLMDEEAAG ADSFFYQYPD  60
HPALLQAQLP FAQILSDSAA SPSVSADTEA ETVASPAADH ATDMVTSAFL KGVEEATKFL  120
PTTDALLLDR TSSLGEVLNG GHARGRKNNR HAAGYEDDDA DADPEPEARR ATKLAAPEPE  180
EAAARQMFDD MMLRERDICM KGAVAADDRR GAHDLLAQVR RHSSPTGDAA QRLAHCFAEG  240
LEARLAGTGS RLYRSLMVRP TSAVDFLKAY QLFLAACCCK KVAFTFSNKT FSDAAAGRRR  300
LHIVDYGIGY GFQWPGLLRG LAARHGGPPE VRITGIDLPQ PGFRPAYQIE ETGRRLATCA  360
RELGVPFRFR GITARRETVS PEDLELDPGE VLVVIGLCHF RHLMDESVVV GRPSPRDEVL  420
GNIRRKTRSG FFSFPEEEED DVALAELSPD HPALLHAQQP FSQILSGAPF SPDQGPVFPG  480
DRGSPNHGGG HEKEEYSTDM FTAAFFRGVD EATKFLPADT ADKPLRSKES AGGGFDACAK  540
GMGGLTISME MPTTDNKKAG KRTRTRGKRH AAKVVDLHTL LLHCAKAVID DRRSAGELLK  600
QIKDHASPTG DAAQRLAYCF AQGLEARLAG TGSQVYRSLT ADRAPLLEFL KAYQLFMSTC  660
CFRKVAFDFA NKAIFDAAIG RSKLHIVDYG LHSGFQWSEL LRLLGARDGG PSEVRITSID  720
LPQPGFRPAN HIAEMGHRLS NCARQFCVPL KFCAVVAQWH TICIDDLNVE PDEVLVVSDL  780
LNFRTLMDVS VVIDRSSPKD MKPDVFVQGI INGSYGTFFL SWFREALFYH SAMFDMLDAT  840
MPRESRLRLV LERGIFGWVA LNAIACEGED RVERGETYKQ WQIRNRRAGL RQLPLNRDSV  900
NMVRNMVKNQ YHKDFVIEED QQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-372059168352GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663691.10.0PREDICTED: scarecrow-like protein 14
TrEMBLJ3NAH50.0J3NAH5_ORYBR; Uncharacterized protein
STRINGOB11G28110.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-102GRAS family protein