PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG243300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 660aa    MW: 73213.4 Da    PI: 5.3334
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG243300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3312.2e-1012766472373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cA+avs +d+  a +lL r+++++sp+gd++qRla +f+e+L+arla+++s+l ++l +++ts    +e l a++l+  vs + 
  Pavir.8KG243300.1.p 276 STLLLHCAQAVSMDDHGSAAQLLRRIKQHSSPRGDANQRLAYCFAEGLEARLAGTGSQLHRSLVAKRTS---AVEFLRAYQLYLAVSCFK 362
                          579************************************************************999999...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                            ++   N +I +a+++++++Hi+D+++++G QWp+Ll+ La+ ++g p++R+T +g pe+g   + ++eetg+rL++fA+++g+pf+f+
  Pavir.8KG243300.1.p 363 MTAYRFSNMTISKAIARKKKLHIVDYGVQYGCQWPSLLDFLAKTKDGLPEVRMTCIGLPEPGfrPAARIEETGRRLSNFATQCGLPFKFQ 452
                          *************************************************************999************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            +a ++e++  ++Lrv+p+E+l+Vn++ + ++l+de +++ s  +rd vLk +++++P+v++++  + ++n++ F +rf eal yysa+
  Pavir.8KG243300.1.p 453 S-IAAKWETICARDLRVEPDEVLVVNCITHFQNLMDEGADICSpsPRDVVLKNIQEMQPDVFILAVVNGSYNAPFFITRFREALFYYSAM 541
                          *.799*******************************9988877669******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd+l+a++pr+se+r +vEr l+gr + nv++ceg++r+er et+++W+ r ++aG++++pl  +++k  +  +r  + + + ++ ++++
  Pavir.8KG243300.1.p 542 FDMLDATAPRDSEQRLVVERDLVGRCALNVISCEGSDRVERPETYRQWQLRNRQAGLRQLPLYPDIVKVLSDKVRDQYHKDFIIDVDHQW 631
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l++gWk+r L+++S W
  Pavir.8KG243300.1.p 632 LLQGWKGRILYAMSTW 647
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.816249628IPR005202Transcription factor GRAS
PfamPF035147.7E-99276647IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MAAAPEPFSP SVFLDLPPTP PRPDVDGEDP AALPDDLVLP YISRMLMEED MDDDEFLYQY  60
PDHPALLQAQ ESYAQILSDA AATNTNGSSG TFTLSPSSSH LPVLANATWP YDPLELTQLL  120
AAGGATANAV CLPRSGEASQ SRVDMDMLNQ AFLKGMEEAN KLLPTSNSLL ISMENHVTAT  180
GQVKKKKNKN GAVDGMLLFQ GSGNGRGRKN SRREGDDLEG RSSKLMVPEP EETGEMVDKM  240
VFDGYMMCLD NMKSMRITMA GGTKANGSAD GAVDLSTLLL HCAQAVSMDD HGSAAQLLRR  300
IKQHSSPRGD ANQRLAYCFA EGLEARLAGT GSQLHRSLVA KRTSAVEFLR AYQLYLAVSC  360
FKMTAYRFSN MTISKAIARK KKLHIVDYGV QYGCQWPSLL DFLAKTKDGL PEVRMTCIGL  420
PEPGFRPAAR IEETGRRLSN FATQCGLPFK FQSIAAKWET ICARDLRVEP DEVLVVNCIT  480
HFQNLMDEGA DICSPSPRDV VLKNIQEMQP DVFILAVVNG SYNAPFFITR FREALFYYSA  540
MFDMLDATAP RDSEQRLVVE RDLVGRCALN VISCEGSDRV ERPETYRQWQ LRNRQAGLRQ  600
LPLYPDIVKV LSDKVRDQYH KDFIIDVDHQ WLLQGWKGRI LYAMSTWVAD DAVNLQSEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-422796478374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-142GRAS family protein