PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG243200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 716aa    MW: 78894.2 Da    PI: 5.2747
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG243200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.22e-1013347062373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           ++L++cA+av++++ + a++lL ++++++sp+gd++qRla++f+ +L+arla+s+s++y++l +++ s   + + l+a++++  +s + 
  Pavir.8KG243200.1.p 334 STVLIHCAQAVATDNRRSATELLRQIKQRSSPRGDATQRLAHCFADGLEARLAGSGSQVYRSLMAERIS---VMDYLKAYQVYLAASCFK 420
                          578************************************************************999998...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                           +++   N +I + ++g ++vHi+D++i++G+QWp+Ll  +a+ ++gpp++RiTg++ p++g   + ++eetg+rL++ A++lgvpf+f+
  Pavir.8KG243200.1.p 421 MMAFKFSNMTISKVIAGRKKVHIVDYGIQYGFQWPSLLGYMATLKGGPPQVRITGIDLPQPGfrPASRIEETGRRLSNCASQLGVPFKFH 510
                          *************************************************************9*9************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           +v  r+e++ +++L+++p+E+l+Vn++ +  +l+de v+++s  +rd vL+ +++++P+ +++   +a+++++ F++rf eal ++sa+
  Pavir.8KG243200.1.p 511 SMVKARWETIGVDDLNIDPDEVLIVNSIRNFGNLMDEGVDIDSpsPRDVVLSNIRKMKPDAFILFVMNASYSAPFFVTRFREALFFHSAM 600
                          *9999**********************************9999889******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd+l+a++pr++++r  vEr l+++ + nvvaceg +r+er et+++W+ r ++aG++++pl+ + +k+++  +r+++ + + ++ ++++
  Pavir.8KG243200.1.p 601 FDMLDATAPRDNHQRFLVERGLFRKCALNVVACEGLDRVERAETYKQWQVRNHRAGLRQLPLDPDGVKDVREKVREHYHKDFVIDVDHQW 690
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l+ gWk+r L+++S W
  Pavir.8KG243200.1.p 691 LLEGWKGRILYAMSTW 706
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.916307687IPR005202Transcription factor GRAS
PfamPF035146.8E-99334706IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MAATPEGLFA DPEPFSPSVF LDLPPTPRPD GNGEGPASSD DLVLPFISRL LMEVNMDDNF  60
LYQFPDHPAL LQAQEPYARI LSDSNSSASG SAATLSPSSD HDPVQLLMSP LRPDMGLHDF  120
TGDDVGAFFL PAQDGASPEL EQNRVQSGTA GDANAFVAGR FGGGTGVQSS ALLDIADEQS  180
PAQLGSTTLP SPAGDGVLAS AFFSSQNGGD MDVLHTAFLK GMEEANKFLP TINNNLLIDQ  240
EGGRGDGSRG RKNRLNWDDD LEAETCRKSK LMVPEPEETG DKVDEMIVNG RELCLKEMEA  300
LRITMGSDAR KNTRKGKGKS AKGRWSADEA VDLSTVLIHC AQAVATDNRR SATELLRQIK  360
QRSSPRGDAT QRLAHCFADG LEARLAGSGS QVYRSLMAER ISVMDYLKAY QVYLAASCFK  420
MMAFKFSNMT ISKVIAGRKK VHIVDYGIQY GFQWPSLLGY MATLKGGPPQ VRITGIDLPQ  480
PGFRPASRIE ETGRRLSNCA SQLGVPFKFH SMVKARWETI GVDDLNIDPD EVLIVNSIRN  540
FGNLMDEGVD IDSPSPRDVV LSNIRKMKPD AFILFVMNAS YSAPFFVTRF REALFFHSAM  600
FDMLDATAPR DNHQRFLVER GLFRKCALNV VACEGLDRVE RAETYKQWQV RNHRAGLRQL  660
PLDPDGVKDV REKVREHYHK DFVIDVDHQW LLEGWKGRIL YAMSTWVADD AISEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-373377068374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-146GRAS family protein