PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG243100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 797aa    MW: 87083.2 Da    PI: 4.8136
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG243100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS350.33e-1074167881373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++ L++cA+ v++gd + a +lL ++++++sp+gd++qR+a++f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  +s +
  Pavir.8KG243100.1.p 416 LRTMLIHCAQSVATGDRRSAVELLRQIKQHSSPRGDATQRMAHCFAEGLEARLAGTGSQVYQSLMAKRTS---VVEFLKAYKLFMAASSL 502
                          5789************************************************************999999...***************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k+  + aNq+Il+av+g +++Hi+ +++++GlQWp Ll+ La R++gpp++R T+++ p++g   + ++eetg+rL++ A e+gvpf+f
  Pavir.8KG243100.1.p 503 KKVHIMFANQTILDAVAGRSKLHIVVYGVQYGLQWPGLLHFLARREGGPPEVRFTAIDLPQPGfrPAYQIEETGRRLSNCALEFGVPFKF 592
                          **************************************************************99999*********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          ++ +a ++e+++ e+L+++p+E+l+V++     +l+desv+++   +rd vL+++++++P+v+++   +  ++++ Fl+rf eal +ysa
  Pavir.8KG243100.1.p 593 QA-IAAKWETVRAEDLNIDPDEVLVVHSECDFSKLMDESVDVDTpsPRDMVLNTIRKMRPNVFILFVLNGTYGAPFFLTRFREALFFYSA 681
                          **.799********************************998776669******************************************* PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          lfd+l+a++pr+++er  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG+k++pl+ +++k ++  +++++ + + ++e++ 
  Pavir.8KG243100.1.p 682 LFDMLDATIPRDNDERLLIERDIFGRSALNVIACEGADRVERPETYKQWQVRNHRAGLKQLPLNPEVVKLVRDKVKNYYHKDFLIDEDNR 771
                          *******************************************************************************889******** PP

                 GRAS 357 slvlgWkdrpLvsvSaW 373
                          +l++gWk+r L+++S W
  Pavir.8KG243100.1.p 772 WLLQGWKGRVLYAMSTW 788
                          ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.921390769IPR005202Transcription factor GRAS
PfamPF035141.0E-104416788IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 797 aa     Download sequence    Send to blast
MSATPEEFLG QGAYLAAPEP FSPSVFLDLP PTPRPAADDD PASSDDLVLP FISRMLMEED  60
IDDKFFYQFP DHPALLLNAQ QPYAQILLRS DESATNSTST SGSGGAAASS TLSPSSDAPA  120
WPYDPIELSQ LLRSPPYADA VLGLHDFADD VDALLLQDQG QATAAGFHHT PPFFDTAGAG  180
GAGGGQPQGA PSIAAQNAAA GAGSPSLAAQ NAGILSSPAD EQDAKTATIA SSTLPAADGD  240
PAALASAFFS GQSGESMDML NMAFLKGMEE ARKFLPTNYS LLINLEDTHT PGQSLPRDSK  300
PATGFAAAQV KEEAVAADGM LLFGGSATGR GRKNRHTDED LLEAETGRNS KLMMPEQEET  360
GAGELFDELM SCNFEGFMKR MNDLRIAMDS ESEKSARRVG GKGARGRQRA DEVVDLRTML  420
IHCAQSVATG DRRSAVELLR QIKQHSSPRG DATQRMAHCF AEGLEARLAG TGSQVYQSLM  480
AKRTSVVEFL KAYKLFMAAS SLKKVHIMFA NQTILDAVAG RSKLHIVVYG VQYGLQWPGL  540
LHFLARREGG PPEVRFTAID LPQPGFRPAY QIEETGRRLS NCALEFGVPF KFQAIAAKWE  600
TVRAEDLNID PDEVLVVHSE CDFSKLMDES VDVDTPSPRD MVLNTIRKMR PNVFILFVLN  660
GTYGAPFFLT RFREALFFYS ALFDMLDATI PRDNDERLLI ERDIFGRSAL NVIACEGADR  720
VERPETYKQW QVRNHRAGLK QLPLNPEVVK LVRDKVKNYY HKDFLIDEDN RWLLQGWKGR  780
VLYAMSTWVA EDNNTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-394207888374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.106590.0callus| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9760950.0EU976095.1 Zea mays clone 622740 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-152GRAS family protein