PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG304600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 626aa    MW: 65618.1 Da    PI: 7.4155
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG304600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.34.9e-922576252374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL e+A a+++g++e+a + La l+  a+++gd+ qRl+a+++ AL++r++ +vs l++ l+         +e+ a  +l++++sP++
  Pavir.7NG304600.1.p 257 RQLLSEAAVALADGNHEAAATHLAALKRAANQHGDAEQRLIAMMVAALSSRIVPTVSALAQHLAELC-----GAEQRAGSQLLHDISPFF 341
                          689***************************************************5555554443333.....556666779********* PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfe 177
                          +++  +a  aI+eav  ++++H +Dfd+s   Q +aL+q La+R+ +  sl++T+v +p s     ++ +l +++e L+++Ae+ g++ +
  Pavir.7NG304600.1.p 342 RLALQAASVAIVEAVGDHRAIHLVDFDVSL-QQHAALIQYLADRRVPGTSLKVTAVTDPGSPytqsQTATLTAIREPLKQLAERAGIEYR 430
                          ****************************97.7*************************9887678889999******************** PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          f+v v  r ++l+ ++L + pgEalaVnl+++l +++desvs +++rde+L+ v+ lsP+vv +veqe+++n++++++rf++a+ +y a+
  Pavir.7NG304600.1.p 431 FEV-VRCRAAELDASRLGCAPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALSPQVVALVEQELNTNTAPLAARFTDACAHYGAI 519
                          **9.6889********************************************************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          ++sl+a+l+res+e++   ++ l++++ n+v  eg +r er+e ++kWr+r+++aGF+pv+l+  +a+q+ + +   +  g +v+ e+g 
  Pavir.7NG304600.1.p 520 LESLDATLGRESSEKKARAEAALAKKAANAVGREGPDRLERCEVFGKWRARFGMAGFRPVALGPGIADQVAARVGPAP-PGITVKAENGV 608
                          ************9988888888********************************************************.9********** PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l l+W++r ++++SaWr
  Pavir.7NG304600.1.p 609 LRLCWMGRVVTVASAWR 625
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.526230606IPR005202Transcription factor GRAS
PfamPF035141.7E-89257625IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYAYGVGS ALQMQLQQRA DAAAGGGVLK RSLGELERWQ HQQQQHVAAQ  60
QALYLRAVKQ RTAAAADIAA LLGGGPTQPL VLSGSSYGGV LASPSSTLSS LTTASRAAVP  120
LLHPHPQPQP QRQVPLMTSS PQTQAFGLSR APPPQPAASS ELFILQELEK QLLNDDDDEP  180
VAAMSGTGSA VTNSEWEETI QQLNSITAAP SPGLPAAAAP NNNNANAGMT RSPSNSSSST  240
ASSSASFSPP TPGAASRQLL SEAAVALADG NHEAAATHLA ALKRAANQHG DAEQRLIAMM  300
VAALSSRIVP TVSALAQHLA ELCGAEQRAG SQLLHDISPF FRLALQAASV AIVEAVGDHR  360
AIHLVDFDVS LQQHAALIQY LADRRVPGTS LKVTAVTDPG SPYTQSQTAT LTAIREPLKQ  420
LAERAGIEYR FEVVRCRAAE LDASRLGCAP GEALAVNLAF ALSHVPDESV SPANPRDELL  480
RRVRALSPQV VALVEQELNT NTAPLAARFT DACAHYGAIL ESLDATLGRE SSEKKARAEA  540
ALAKKAANAV GREGPDRLER CEVFGKWRAR FGMAGFRPVA LGPGIADQVA ARVGPAPPGI  600
TVKAENGVLR LCWMGRVVTV ASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-3427562522375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.196840.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279750.0KJ727975.1 Zea mays clone pUT6089 GRAS transcription factor (GRAS52) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976581.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3Y5W20.0K3Y5W2_SETIT; Uncharacterized protein
STRINGSi009601m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-82SCARECROW-like 8