PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG286300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 355aa    MW: 40000.6 Da    PI: 7.9876
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG286300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.69.2e-27198247352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++i+l ++++yF+lpi++A+k+L++++++LKr+CR+yGI+RWPhRkiksl
  Pavir.7NG286300.1.p 198 DNITLAEIAQYFHLPIREASKTLKIGVSILKRKCRKYGIPRWPHRKIKSL 247
                          79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.838182267IPR003035RWP-RK domain
PfamPF020424.3E-22199247IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MDMDAAVSTL TALSVFASTV EHASFRSVHG YRVVGRKDGK WLRWVERQFV LSLSVPPCRE  60
VAVPAASPRI LLAGWHGWPL FREGQTVGTW RCIVAFDSVA AVAPSSPPPP VLSPLVNPQL  120
ECLPNLYRDL QKVFRFQKVE KVPLMVRRNA KEQPIREQEK TSDEADSSGS ESDGDPQSDK  180
ELAPSVQKQP RANRKHIDNI TLAEIAQYFH LPIREASKTL KIGVSILKRK CRKYGIPRWP  240
HRKIKSLESL ISDLEYVLDD DQGEDAQQEL QKIEEEKQAA AIKALTKRKK MLENEKEIIQ  300
QKPALDLMTE TKLFREDVFK RRYRASKSVA SEAEEDAAER EGDHTAEASL GPDD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.165670.0callus| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7NG286300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025825577.10.0protein RKD5
TrEMBLA0A3L6QAH30.0A0A3L6QAH3_PANMI; Protein RKD5
STRINGPavir.Ga01021.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-33RWP-RK domain-containing protein