PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG273800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 370aa    MW: 37618.3 Da    PI: 11.1393
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG273800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75e-41103179177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +CqvegC+a+l+ ak+yhrrhkvC vhskap v+v g eqrfCqqCsrfh++sefD++krsCrrrLa+hnerrrk++
  Pavir.7NG273800.1.p 103 RCQVEGCHAELAGAKDYHRRHKVCAVHSKAPRVVVLGAEQRFCQQCSRFHAVSEFDDAKRSCRRRLAGHNERRRKSN 179
                          6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-3499165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.445101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-38102181IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31104177IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MHWAPAGSSP PYPQQPFVAR PGGGAASHHH HHQQQQELTC LKLGKRPCCW AGAVGTPAAQ  60
AGAALPPQVH GNGAAAGGAS GTAAEGRRKE KAGAATAAAG APRCQVEGCH AELAGAKDYH  120
RRHKVCAVHS KAPRVVVLGA EQRFCQQCSR FHAVSEFDDA KRSCRRRLAG HNERRRKSNA  180
SEAMARGAAH PHAMAPFGHG FLPPCGLPAA SPAGALSLLS SARGAGAPWL GPAPYISARS  240
SAALDELIAE NRAALLAWHF SDRLAPGRHR LAPPSSAAHH PHNGAGAWRR RPVLPRGAGQ  300
RGAHDAGPHA AAAAAATTAA PAGAPPFRPV PERAGAAARP PRTKDNGGAA GCSSDDAWAP  360
AGGGGARAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-3295177284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7NG273800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9646561e-110EU964656.1 Zea mays clone 280651 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824676.11e-144squamosa promoter-binding-like protein 7
SwissprotQ7XT421e-103SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A3L6PWC61e-157A0A3L6PWC6_PANMI; Squamosa promoter-binding-like protein 7
STRINGPavir.Gb01121.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-35squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]