PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG216500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 942aa    MW: 102706 Da    PI: 6.5077
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG216500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.88.1e-27566616252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sl++l+kyFs++++dAA +Lgvc+T+LKriCRq+GI+RWP+Rki+++
  Pavir.7NG216500.1.p 566 EKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKISKV 616
                          899*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.847555636IPR003035RWP-RK domain
PfamPF020424.5E-24569616IPR003035RWP-RK domain
SuperFamilySSF542776.45E-24830924No hitNo description
Gene3DG3DSA:3.10.20.2401.9E-22836918No hitNo description
PROSITE profilePS5174525.156839921IPR000270PB1 domain
SMARTSM006663.1E-20839921IPR000270PB1 domain
PfamPF005645.3E-17840920IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 942 aa     Download sequence    Send to blast
MDMPMPSNRA GCNGNISSPM GSSDDPFGVA ATMNFDGYSE LCSPSVADQI FSMLNDPSAA  60
QQMFAMWSSL GSSPRASAMR DDMPFDTYSG PMDATAASTQ RSNSVSALSP TGVDRELKVS  120
DELVPQNGLQ QGSNIIPRSV GNFLADKMLM ALSLFRKSLS DGVLAQVWMP VEHDGRVVLS  180
TFEQPFLLDQ DLAGYREVSR NFLFSVKEEP GLHLGLPGRV FISGVPEWTS SVLYYSKPEY  240
LRMDHALRHD IRGSLAMPIY DPSKGSCCAV LELVTNKEKS DFDAEMDSVC NALQAVNLLT  300
TTDRSNQKVY SENQKSAFTE ILDVLRAICH AHMLPLALTW VPTSNGINNG YGAGKNIGVD  360
SQSGKSVLRI HESACYINDA KMQGFLHACT ERHLEKGEGI AGRALKSNLP FFSPDIKEYS  420
IEDYPLAHHA RKFGLHAAVA IRLRSTYTGN DDYILEFFLP VNCKGCGEQQ MLLNNLSSTM  480
QRICKSLRTV SEAEDDNAGA SGTAMHKKTN GTLPTGNTES SSHDDQPITE SAFQDLSLGD  540
KQGDREPDQA HSSSMRVAEK KRSTSEKNFS LDVLRKYFSG SLRDAAMSLG VCPTTLKRIC  600
RQHGISRWPS RKISKVNRSL KKIQTVINSV HGVDRSLQYD PATGSLVPAA SLPDKMQFSA  660
CDTLPTSSVG KSMEKKSSPK SEQGFSSPDG WQRETCQFHV SSISKREDDE VRMLANNNNG  720
RRNCASDVAK VTPHSNSEGA KGPLYTTGAV NSLCTREIVY INSPTSLHPS IDSAEDPTMG  780
RNSSLVQQAD VTMVDGHDTK EHIHPSTSGT TDSSSGSASS QPTFKGNLGN APKDRSSPAL  840
TVKATYNGDT VRFKFLPAMG WYHLLEQIAK RFKLTTGAFQ LKYKDDEDEW VILANDSDLQ  900
ECVDILDSIG SRNVKLQVRD LPCHISSSGS SSCLQVEAHS P*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.79770.0callus| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7NG216500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277560.0KJ727756.1 Zea mays clone pUT5699 NLP transcription factor (NLP3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823107.10.0protein NLP2-like
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLA0A2S3I8330.0A0A2S3I833_9POAL; Uncharacterized protein
STRINGPavir.J35714.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]