PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG066100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TCP
Protein Properties Length: 95aa    MW: 9696.95 Da    PI: 4.3111
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG066100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP683.3e-212472873
                  TCP 28 caarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                         +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  Pavir.7NG066100.1.p  2 VAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 47
                         8*************************************66666333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136919.483136IPR017887Transcription factor TCP subgroup
PfamPF036343.1E-16245IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MVAARVFQLT RELGHRTDGE TIEWLLRQAE PSIIAATGTG VTPEEAPPAP VPVSPVAATA  60
SLMPVPYYTA LLMQPPPTAD SASGSGTAAQ ANNN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.66099e-35callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975168.11e-54PREDICTED: transcription factor PCF1-like
SwissprotO238751e-34PCF1_ORYSJ; Transcription factor PCF1
TrEMBLK7TSC88e-47K7TSC8_MAIZE; TCP transcription factor
STRINGGRMZM2G096610_P012e-46(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.15e-20TCP family protein