PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG061200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 256aa    MW: 28571 Da    PI: 10.8789
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG061200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP508e-16161204448
                          STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                  SBP   4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                          v+gC +dls+ak yh +hkvC++h+k+p vlv+ +eq fCqqC r
  Pavir.7NG061200.1.p 161 VPGC-VDLSSAKPYHCHHKVCSMHTKTPRVLVASIEQPFCQQCMR 204
                          7778.7*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114112.896156232IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.2E-13160204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-14161204IPR004333Transcription factor, SBP-box
PfamPF031102.6E-10161204IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVNGDSYPLP SHYPDGGGAA PFRPSLRRPL RRRFYLRLRT RPRLNAPELR LHLRPRPPPR  60
LRCPFPAVPS RIQVERWPAW PGWIYGGGSR GEGGSTAAVA VTCPDYGRRP RVLAARWAGV  120
MRTDFAYICA ESGPSGGCIG RQEGKGSGHR WRPVPRRAAM VPGCVDLSSA KPYHCHHKVC  180
SMHTKTPRVL VASIEQPFCQ QCMRKEGSEG LRMTAKKMRR VVYVLDGDDV NISPYNLRVP  240
YYQWLNGFAA DPQAA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7NG061200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-11squamosa promoter binding protein-like 9