PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG320000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LFY
Protein Properties Length: 318aa    MW: 34481.1 Da    PI: 9.7503
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG320000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY463.12e-141130481385
              FLO_LFY  81 mkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglge 170
                          m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+++      r      +  ++lda+s+e+ls+e++     aagsgg  + e
  Pavir.7KG320000.1.p   1 MTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERGRVMSLG---GRF-----HAGSTLDAASEEVLSDERD-----AAGSGGVAEDE 77 
                          9****************************************965...455.....35678***********976.....77888888777 PP

              FLO_LFY 171 aelvaaeekkseeekkkaskkkqkrkkkkelkse.......ededeeeeededeeg..........sgedgeerqrehPfivtepgevar 243
                          a+  +++ kk+ ++    ++k +k ++kkel+         +    + +ed  + g          ++ +g erqrehPf+vtepgevar
  Pavir.7KG320000.1.p  78 AGRRMVTGKKQAKKGAAGTRKGKKARRKKELR-PldvlgdeN----DGDEDGGGGGgsestessagGRGGGGERQREHPFVVTEPGEVAR 162
                          77777776554444443333322222222222.124554331....22222222223344444543555667****************** PP

              FLO_LFY 244 gkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenv 333
                          +kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenv
  Pavir.7KG320000.1.p 163 AKKNGLDYLFHLYEQCRVFLLQVQSIAKLGGHKAPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENV 252
                          ****************************************************************************************** PP

              FLO_LFY 334 GawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                          Gawrqacy+plv+iaar+g+d+davf+ahprL+iWYvPt+LrqLCh++r ++
  Pavir.7KG320000.1.p 253 GAWRQACYAPLVEIAARHGFDVDAVFAAHPRLAIWYVPTRLRQLCHQARGAQ 304
                          ************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016989.1E-1571303IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MTERELDDMM AALAGLFRWD VLLGERFGLR AALRAERGRV MSLGGRFHAG STLDAASEEV  60
LSDERDAAGS GGVAEDEAGR RMVTGKKQAK KGAAGTRKGK KARRKKELRP LDVLGDENDG  120
DEDGGGGGGS ESTESSAGGR GGGGERQREH PFVVTEPGEV ARAKKNGLDY LFHLYEQCRV  180
FLLQVQSIAK LGGHKAPTKV TNQVFRYAKK CGASYINKPK MRHYVHCYAL HCLDEEASNA  240
LRRAYKARGE NVGAWRQACY APLVEIAARH GFDVDAVFAA HPRLAIWYVP TRLRQLCHQA  300
RGAQHAAAAG LPPPPMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1001433022161PROTEIN LEAFY
2vy2_A1e-1001433022161PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137143GGRGGGG
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In the vegetative phase, expressed in shoot meristems and leaf primordia. In the reproductive phase, present in the meristems of primary and secondary branches at primordial and elongating stages, but later transiently down-regulated from the meristems, when the meristem identity change from inflorescence to spikelet. Subsequent expression recovery when spikelets are differentiated, with an accumulation in floral meristems and in primordia of all floral organs, including lodicules, stamens, carpels and ovules. {ECO:0000269|PubMed:21910771}.
UniprotTISSUE SPECIFICITY: In very young panicle but not in mature florets, mature leaves, roots or apical meristems. {ECO:0000269|PubMed:9482818}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7KG320000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.10.0probable transcription factor FL
SwissprotQ0JAI11e-172FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC120.0K3YC12_SETIT; Uncharacterized protein
STRINGPavir.Ga00621.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.13e-97floral meristem identity control protein LEAFY (LFY)