PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG311800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 502aa    MW: 52459.2 Da    PI: 6.2952
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG311800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.93.2e-921335012374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL e+A a+++g++e+a + La l+  a+++gd+ qRl+a+++ AL++r++ + s l        ++    +e+ a  +l++++sP++
  Pavir.7KG311800.1.p 133 RQLLSEAAVALADGNHEAAATHLAALKRAANQHGDAEQRLIAMMVAALSSRIVPTASALT----QHLAE-LCGAEQRAGSELLHDISPCF 217
                          689***************************************************433333....33332.335566677789******** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfe 177
                          +++  +a  aI+eav   +++H +Dfd+s + Q +aL+q La+R+ +  sl++T+v +p s     ++ +l ++ge L+++Ae+ g++ +
  Pavir.7KG311800.1.p 218 RLALHAASVAIVEAVGDRRAIHLVDFDVS-PQQHAALIQYLADRRVPGTSLKVTAVTDPGSPytqsQTATLAAIGEPLKQLAERAGIEYR 306
                          ***************************97.89*************************988767888999********************* PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          f+v v+ r ++l+ ++L++ pgEalaVnl+++l +++desvs +++rde+L+ v+ lsP+vv +veqe+++n++++++rf++a+ +y a+
  Pavir.7KG311800.1.p 307 FKV-VSCRAAELDASKLDCAPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALSPQVVALVEQELNTNTAPLAARFTDACAHYGAI 395
                          **9.7999********************************************************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          ++sl+a+l+res e++   ++ ++r++ n+   eg +r er+e ++kWr+r+++aGF+pv+l+  +a+q+ + +   +  g +v+ e+g 
  Pavir.7KG311800.1.p 396 LESLDATLGRESAEKKARAEAAVARKAANAAGREGPDRLERCEVFGKWRARFGMAGFRPVALGPGIADQVAARVGPAP-PGITVKAENGV 484
                          ************8888888888********************************************************.9********** PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l l+W++r ++++SaWr
  Pavir.7KG311800.1.p 485 LRLCWMGRVVTVASAWR 501
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.604106482IPR005202Transcription factor GRAS
PfamPF035141.1E-89133501IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MHPQPQRQVP LMTSSPQTQA FGLSRAPPPQ PAASSELFIL QELEKQLLDD DDDEPVAAMS  60
GTGSAVTNSE WEETIQQLNS ITAAPTPGLP ASAAPNNNNG ANAGMTRSPS NSSSSTASSS  120
ASCSPPTPGA ASRQLLSEAA VALADGNHEA AATHLAALKR AANQHGDAEQ RLIAMMVAAL  180
SSRIVPTASA LTQHLAELCG AEQRAGSELL HDISPCFRLA LHAASVAIVE AVGDRRAIHL  240
VDFDVSPQQH AALIQYLADR RVPGTSLKVT AVTDPGSPYT QSQTATLAAI GEPLKQLAER  300
AGIEYRFKVV SCRAAELDAS KLDCAPGEAL AVNLAFALSH VPDESVSPAN PRDELLRRVR  360
ALSPQVVALV EQELNTNTAP LAARFTDACA HYGAILESLD ATLGRESAEK KARAEAAVAR  420
KAANAAGREG PDRLERCEVF GKWRARFGMA GFRPVALGPG IADQVAARVG PAPPGITVKA  480
ENGVLRLCWM GRVVTVASAW R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3315150122375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.196840.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0840740.0BT084074.1 Zea mays full-length cDNA clone ZM_BFb0071H03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976581.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3Y5W20.0K3Y5W2_SETIT; Uncharacterized protein
STRINGSi009601m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-83SCARECROW-like 8