PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG294700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 336aa    MW: 38167.8 Da    PI: 9.7878
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG294700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.32.3e-26201250352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++i+l ++++yF+lpi++A+k+L++++++LKr+CR+yGI+RWPhRkiksl
  Pavir.7KG294700.1.p 201 DSITLVEIAQYFHLPIREASKTLKIGVSILKRKCRKYGIPRWPHRKIKSL 250
                          689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.77185270IPR003035RWP-RK domain
PfamPF020421.5E-21202250IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDMDAAVSTL TALSVFDSTV EHGAFRSVHG YKVIGRKDGK WLRWERWVER QFVLSLSVPP  60
CREVAVPAAS PRILLAGWHG RPVFREGQTV GPWRCIVAFD SVAAVAPSSP PPPVLSPLVN  120
PQLECLPNLY RDLQKVFRFQ KVEKVPQMVH RNAKEQPIRS GEQEKTSDEA DSSGSDSDGD  180
PQSDKEPPVQ KQPRANRKHI DSITLVEIAQ YFHLPIREAS KTLKIGVSIL KRKCRKYGIP  240
RWPHRKIKSL ESLINDLEYV LDDDPGEDAQ QELQKIEEEK RAAAIKALTK RKKMLESEKE  300
IIQQKPALDL MTETKQFRED VFKRRHRASK SVVME*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.165670.0callus| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7KG294700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025825577.10.0protein RKD5
TrEMBLA0A3L6QAH30.0A0A3L6QAH3_PANMI; Protein RKD5
STRINGPavir.Ga01021.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-36RWP-RK domain-containing protein