PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG223400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 942aa    MW: 102592 Da    PI: 6.5064
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG223400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.45.2e-27565615252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sl++l+kyFs++++dAA +Lgvc+T+LKriCRq+GI+RWP+Rki+++
  Pavir.7KG223400.1.p 565 EKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKINKV 615
                          899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.79554635IPR003035RWP-RK domain
PfamPF020421.5E-24568615IPR003035RWP-RK domain
SuperFamilySSF542771.07E-23830921No hitNo description
Gene3DG3DSA:3.10.20.2407.9E-22835917No hitNo description
PROSITE profilePS5174524.819838920IPR000270PB1 domain
SMARTSM006661.8E-19838920IPR000270PB1 domain
PfamPF005642.4E-16839919IPR000270PB1 domain
CDDcd064079.97E-31839919No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 942 aa     Download sequence    Send to blast
MDMPMPSNRA GCNGNISSPM GSSDDPFGVA ATMNFDGYSE LCSPSVADQI FSMLNDPSAA  60
QQMFAMWSSL GSSPRASAMR DDMPFDTYSG PMDATAASTQ KSNSASALSP TGVDRELKVS  120
DELVPHNGSQ QGSNIIPRSV GNFLADKMLM ALSLFRKSLS DGVLAQVWMP VEHNGRVLLS  180
TFEQPFLLDQ DLAGYREVSR NFLFSVKEEP GLHLGLPGRV FISGVPEWTS SVLYYSKLEY  240
LRMDYALRHE IRGSLAMPIY DPSKGSCCAV LELVTNKEKS DFDAEMDSVC NALQAVNLLT  300
TTDRSNQKVY SENQKSAFTE ILDVLRAICH AHMLPLALTW VPTSNGIHNG YCAGKNIGVD  360
SQSGKAVLRI HESACYINDA KMQGFLHACT ERHLEKGEGI AGRALKSNLP FFSPDIREYS  420
IEDYPLAHHA RKFGLHAAVA IRLRSTHTGN DYILEFFLPV NCKGCEEQQV LLNNLSSTMQ  480
RICKSLRTVS EAEADNSGTS GTAMHKKTNG TLPTGNTESS SHDDQPITES AFQDLSLGDK  540
QGDREPDQAH SSSMRVAEKK RSTSEKNFSL DVLRKYFSGS LRDAAMSLGV CPTTLKRICR  600
QHGISRWPSR KINKVNRSLK KIQTVINSVH GVDRSLQYDP ATGSLVPAAS LPDKMQFSAC  660
DTLPTSSVGK PMEEKSSPKS EQGFSSPVGW QRETRQFHVS SISKREGDEV RMLANNNNGS  720
RNCASDVAKV TPHSNSEGAQ GPLYPIGGVN ALCTGQIGYI NSPTSLHPSI DSAEDPTMGR  780
NSSFVQQADV IMVDGHDTKE HTHPSTSGTT DSSSGSASSQ PCFKGNPGNV PKDRSSPALT  840
VKATYNSDTV RFKFLPAMGW YHLLEEIAKR FKLTTGAFQL KYKDDEDEWV ILANDSDLQE  900
CVDVLDSIGS HNVKLLVRDL PCLVSSSGSS SCLMQVEAHS P*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.79770.0callus| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7KG223400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277560.0KJ727756.1 Zea mays clone pUT5699 NLP transcription factor (NLP3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823107.10.0protein NLP2-like
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLA0A2S3I8330.0A0A2S3I833_9POAL; Uncharacterized protein
STRINGPavir.Ga01502.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]