PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG113800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 163aa    MW: 16761.3 Da    PI: 10.4459
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG113800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.23.8e-10821264187
                          TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                   B3  41 esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                           +grsW +++  +++++   l++GW++F+ + gL+ gD +v++l + 
  Pavir.7KG113800.1.p  82 WRGRSWGMRF--TGGRQVQRLEAGWRGFALDAGLRLGDACVLELLDA 126
                          579*******..9999999************************7654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-1343128IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-1243136IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.40546141IPR003340B3 DNA binding domain
PfamPF023627.3E-848127IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASDAAPKGK SAAASSSAER SAAAAGPDGG DQLQPGILPL LGKPYFACVM CKSHVRPPFQ  60
VVVPRSLAPF LPAATAPATV AWRGRSWGMR FTGGRQVQRL EAGWRGFALD AGLRLGDACV  120
LELLDAGPDR VAFRAQVLRA DIPAAIRGRA GGDTSASPIL ID*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7KG113800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025825273.16e-88B3 domain-containing protein Os04g0386900-like
SwissprotQ7XLP42e-67Y4869_ORYSJ; B3 domain-containing protein Os04g0386900
TrEMBLA0A2S3I5Y22e-87A0A2S3I5Y2_9POAL; Uncharacterized protein
STRINGPavir.Ga01965.1.p1e-108(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89543545
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]