PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG340600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 253aa    MW: 27358.9 Da    PI: 10.2952
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG340600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.85.6e-0972130563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          k+++r + NR +A rs +RK  +i eLe+kv+ ++ e +aL+ +l  l+   a l++e+
  Pavir.6NG340600.1.p  72 KKAKRIINNRQSAARSKERKMRYISELERKVQFMQREATALATQLALLQRDTAGLTAEN 130
                          89**********************************************99999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1468132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.70370133IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-870126No hitNo description
PfamPF001709.0E-872129IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-1072126No hitNo description
CDDcd147033.05E-2073124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MAAVGGEATQ TSSAPGAGLR PKHHQRHSMD ASSSIDTENL FGTSAMEGVS PAEAKKAMSA  60
AKLAELALID PKKAKRIINN RQSAARSKER KMRYISELER KVQFMQREAT ALATQLALLQ  120
RDTAGLTAEN SELKIRLQNT EQQVHLQDAL NEALKSELQR LKMATGQMGT SGGGAMNLGT  180
SPHPFALSQQ VFHPNQAMPP SLAMQQQHPN QPLHPLQTQQ LQQAALNLNM KGPAPAPNQW  240
QWGDAWSESS SS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG340600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822526.11e-149transcription factor RF2a-like
SwissprotQ69IL41e-72RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A3L6RJ031e-152A0A3L6RJ03_PANMI; Transcription factor RF2a-like
STRINGPavir.Fa00247.1.p1e-157(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.17e-57bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]