PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG338700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 367aa    MW: 39019.9 Da    PI: 6.1842
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG338700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.91.1e-08186244563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          k+++r + NR +A rs +RK  +i eLe+kv+ ++ e +aL+ +l  l+   a l++e+
  Pavir.6NG338700.1.p 186 KKAKRIINNRQSAARSKERKMRYISELERKVQFMQREATALATQLALLQRDTAGLTAEN 244
                          89**********************************************99999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575116No hitNo description
SMARTSM003381.0E-14182246IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.703184247IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.3E-8184240No hitNo description
PfamPF001701.6E-7186235IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.45E-10186240No hitNo description
CDDcd147038.69E-22187238No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MDMDKTPIPG GGGGGCAGNV PAMQSSCDAV AASPAPHTEC DISRMPDSPM RKPGHRRALS  60
DIIGLPEDLD LGAPGAGDGL ALSDENEEEL FSMFLDVEKL NSRCGASESE SSCAMAAVGG  120
EATQTSSAPG AGLRPKHHQR HSMDASSSID TENLFGTSAM EGVSPAEAKK AMSAAKLAEL  180
ALIDPKKAKR IINNRQSAAR SKERKMRYIS ELERKVQFMQ REATALATQL ALLQRDTAGL  240
TAENSELKIR LQNTEQQVHL QDALNEALKS ELQRLKMATG QMGTSGGGAM NLGTSPHPFA  300
LSQQVFHPNQ AMPPSLAMQQ QHPNQPLHPL QTQQLQQAAL NLNMKGPAPA PNQWQWGDAW  360
SESSSS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG338700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0359850.0BT035985.1 Zea mays full-length cDNA clone ZM_BFb0090M08 mRNA, complete cds.
GenBankJX4699280.0JX469928.1 Zea mays subsp. mays clone UT3186 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822526.10.0transcription factor RF2a-like
SwissprotQ69IL41e-111RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A2S3I4C00.0A0A2S3I4C0_9POAL; Uncharacterized protein
STRINGPavir.Fa00247.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-69bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]