PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG327200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 440aa    MW: 45284.4 Da    PI: 8.0291
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG327200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.62.6e-41128204278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C vegC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh l efD++krsCr+rL++hn+rrrk+q+
  Pavir.6NG327200.1.p 128 CAVEGCTADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLAEFDDTKRSCRKRLDGHNRRRRKPQP 204
                          **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-34119189IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.043125202IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.76E-39126207IPR004333Transcription factor, SBP-box
PfamPF031104.4E-31128201IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MDWDLKAPGA WDLAELEQDH AGGAAAAAAG AAGTSGGHGN AAASAYRPPG APECSVDLKL  60
GGLGECELGA GPARRQPAAA AGKAPAPAAS GAVAAAGPSS PGPGAPAKRA RPAGGGGGQQ  120
QQQQCPSCAV EGCTADLSKC RDYHRRHKVC EAHSKTPVVV VAGREMRFCQ QCSRFHLLAE  180
FDDTKRSCRK RLDGHNRRRR KPQPDTMASA SFIASQQGTR FSPFAAPRLD ANWPGVIKTE  240
ESPYYAHQIP LGTSNRHNFV GSSSAYAKEG RRFPFLQEGE INFATGVVLE APASARQPVL  300
KTAAPPESST GGKMFSDGLT RVLDSDCALS LLSAPANSSS IDVSRMVPTE HVPMAQPVVS  360
GLQFGSPSWF SRPQAAAAAA ATAGFPSCPV VEGGQQLNTV LSSNDNEMNY SGMFHVGGSG  420
GGGEGSSDGT SSSLPFSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-261282011184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184201KRSCRKRLDGHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Strongly expressed in immature ears and weakly in husks. Found in the inflorescence meristem of the developing ear, in the spikelet pair primordia, the glume primordia, the cupule forming region and other floral organs. Not detected in other tissues. {ECO:0000250|UniProtKB:Q49I55}.
Functional Description ? help Back to Top
Source Description
UniProtSBP transcriptional regulator probably involved in the domestication of maize. Acts as a transcriptional repressor binding to a 5'-GTAC-3' motif. May repress the growth of lateral branches in length and numbers. {ECO:0000250|UniProtKB:Q49I55}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG327200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819972.10.0teosinte glume architecture 1-like
SwissprotQ49I571e-171TGA1B_MAIZE; Teosinte glume architecture 1
TrEMBLA0A3L6PRM30.0A0A3L6PRM3_PANMI; Teosinte glume architecture 1
STRINGSi013747m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-39SBP family protein
Publications ? help Back to Top
  1. Schnable PS, et al.
    The B73 maize genome: complexity, diversity, and dynamics.
    Science, 2009. 326(5956): p. 1112-5
    [PMID:19965430]