PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG323100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 339aa    MW: 36027.3 Da    PI: 8.8653
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG323100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.7e-412096278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                         C vegC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh l efD++krsCr+rL++hn+rrrk+q+
  Pavir.6NG323100.1.p 20 CAVEGCTADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLAEFDDTKRSCRKRLDGHNRRRRKPQP 96
                         **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-351181IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.0431794IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-391899IPR004333Transcription factor, SBP-box
PfamPF031102.9E-312093IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
AKRPRPAGGG GQQQQQCPSC AVEGCTADLS KCRDYHRRHK VCEAHSKTPV VVVAGREMRF  60
CQQCSRFHLL AEFDDTKRSC RKRLDGHNRR RRKPQPDTMA SASFIASQQG TRFSPFAAPR  120
LDAANWPGVI KTEESPYYAH QIPLGTSNRH HFVGSSSAYA KEGRRFPFLQ EGEINFATGV  180
VLEAPASARQ PVLKTAAPPE SSSGSTVGKM FSDGLTRVLD SDCALSLLSA PANSSGIDVS  240
RMVRPTEHVP MAQPVVSGLQ FGSPSWFSRP QASAGGGAAA ATAGFPSCPV VEGGQQLNTV  300
LSSNDNEMNY SGMFHVGGSG GGGEGSSDVP SSLPFSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-2720931184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115KRPRP
27693KRSCRKRLDGHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Strongly expressed in immature ears and weakly in husks. Found in the inflorescence meristem of the developing ear, in the spikelet pair primordia, the glume primordia, the cupule forming region and other floral organs. Not detected in other tissues. {ECO:0000250|UniProtKB:Q49I55}.
Functional Description ? help Back to Top
Source Description
UniProtSBP transcriptional regulator probably involved in the domestication of maize. Acts as a transcriptional repressor binding to a 5'-GTAC-3' motif. May repress the growth of lateral branches in length and numbers. {ECO:0000250|UniProtKB:Q49I55}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG323100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8835600.0AY883560.1 Zea mays cultivar inbred line W22 teosinte glume architecture 1 (tga1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819972.10.0teosinte glume architecture 1-like
SwissprotQ49I571e-162TGA1B_MAIZE; Teosinte glume architecture 1
TrEMBLA0A3L6PRM30.0A0A3L6PRM3_PANMI; Teosinte glume architecture 1
STRINGPavir.J28847.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-42SBP family protein
Publications ? help Back to Top
  1. Schnable PS, et al.
    The B73 maize genome: complexity, diversity, and dynamics.
    Science, 2009. 326(5956): p. 1112-5
    [PMID:19965430]