PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG315100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 286aa    MW: 30517.9 Da    PI: 8.5105
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG315100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP881.1e-271512676
                         HHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                  SBP 26 vhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
                         +hskap v+v+g+eqrfCqqCsrfh+l+efD++krsCrrrL +hnerrr++
  Pavir.6NG315100.1.p  1 MHSKAPLVVVNGIEQRFCQQCSRFHQLHEFDQQKRSCRRRLMGHNERRRRP 51
                         6************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1036126.54E-25154IPR004333Transcription factor, SBP-box
PfamPF031102.9E-20150IPR004333Transcription factor, SBP-box
PROSITE profilePS5114122.572151IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.8E-17138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MHSKAPLVVV NGIEQRFCQQ CSRFHQLHEF DQQKRSCRRR LMGHNERRRR PPAGPLASRY  60
GRLAASLGEP GRFRSFLLDF SYPRVPSSMR DGWQAAQPGE RVPGSMQWQS SLDPHHHSAI  120
AGYGAHSYGS QGSPSSGPPV FPGPELPPGG CLAGVPADSS CALSLLSTQP WDTTQSAGHS  180
RAASMPATAG FDGNPVAPSV MASSYIMPSP WMGSQGHAGG RNMTPQLPPE VPLDEVHSGS  240
SSRHGQFSGE LELALQGSRP APAPRIDQGS TSTFDQASNT SDWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-181503584squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.113960.0root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG315100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025821402.10.0squamosa promoter-binding-like protein 14
SwissprotQ7EXZ21e-128SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLA0A290G8S30.0A0A290G8S3_PANVG; Squamosa promoter binding-like protein 4a
STRINGPavir.Fb01946.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-27squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Miura K, et al.
    OsSPL14 promotes panicle branching and higher grain productivity in rice.
    Nat. Genet., 2010. 42(6): p. 545-9
    [PMID:20495564]
  3. Jiao Y, et al.
    Regulation of OsSPL14 by OsmiR156 defines ideal plant architecture in rice.
    Nat. Genet., 2010. 42(6): p. 541-4
    [PMID:20495565]
  4. Springer N
    Shaping a better rice plant.
    Nat. Genet., 2010. 42(6): p. 475-6
    [PMID:20502488]
  5. Wang Y,Li J
    Branching in rice.
    Curr. Opin. Plant Biol., 2011. 14(1): p. 94-9
    [PMID:21144796]
  6. Wang J,Kong L,Gao G,Luo J
    A brief introduction to web-based genome browsers.
    Brief. Bioinformatics, 2013. 14(2): p. 131-43
    [PMID:22764121]
  7. Luo L,Li W,Miura K,Ashikari M,Kyozuka J
    Control of tiller growth of rice by OsSPL14 and Strigolactones, which work in two independent pathways.
    Plant Cell Physiol., 2012. 53(10): p. 1793-801
    [PMID:22960246]
  8. Liu Q, et al.
    The alteration in the architecture of a T-DNA insertion rice mutant osmtd1 is caused by up-regulation of MicroRNA156f.
    J Integr Plant Biol, 2015. 57(10): p. 819-29
    [PMID:25677853]
  9. Cruz-Garcia GS,Struik PC
    Spatial and Seasonal Diversity of Wild Food Plants in Home Gardens of Northeast Thailand1.
    Econ. Bot., 2015. 69(2): p. 99-113
    [PMID:26160981]
  10. Srikanth B, et al.
    Enhanced expression of OsSPL14 gene and its association with yield components in rice (Oryza sativa) under low nitrogen conditions.
    Gene, 2016. 576(1 Pt 3): p. 441-50
    [PMID:26519999]
  11. Perignon M, et al.
    Impact of Multi-Micronutrient Fortified Rice on Hemoglobin, Iron and Vitamin A Status of Cambodian Schoolchildren: a Double-Blind Cluster-Randomized Controlled Trial.
    Nutrients, 2016.
    [PMID:26751473]
  12. Kim SR, et al.
    Development and validation of allele-specific SNP/indel markers for eight yield-enhancing genes using whole-genome sequencing strategy to increase yield potential of rice, Oryza sativa L.
    Rice (N Y), 2016. 9(1): p. 12
    [PMID:26987543]