PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG310500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 1111aa    MW: 121464 Da    PI: 7.0661
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG310500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1283.6e-40178255178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C+adl++ak+yhrrhkvCe+hsk++++lv+ ++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Pavir.6NG310500.1.p 178 MCQVDDCRADLTSAKDYHRRHKVCETHSKTTKALVASQMQRFCQQCSRFHPLAEFDEGKRSCRRRLAGHNRRRRKTQP 255
                          6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33172240IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.838176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-37177256IPR004333Transcription factor, SBP-box
PfamPF031101.2E-29179252IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1111 aa     Download sequence    Send to blast
MQREVGPQVA PPLFLHQIQP LPPHAAAAKK RAHPWPAAVA PARAAAAGDG NWNPKMWDWD  60
SRALIARPSS DALRLGGGGA QAQQQQPQPA SAAAKAAEAH RQGNGALNLQ LGLRKDAATP  120
MDTSPPAPVA SSPSPPASAA AGQEAVVRPS KRVRSGSPGS AGGSGGGGGA NGGASYPMCQ  180
VDDCRADLTS AKDYHRRHKV CETHSKTTKA LVASQMQRFC QQCSRFHPLA EFDEGKRSCR  240
RRLAGHNRRR RKTQPTDVAS QLLLPGNQEN AANRTQDIVN LITVIARLQG SNTGKAPSIA  300
PIPDKQNLVE IISKINSLNN TTSVAKSPPL EVVDLNASQE QQEDSMQKTA NGIDKQTVPS  360
TMDLLAVLST GLATSTPETN TSQSQGSSDS SGNNKSKSHS TEPATVVNSH DKSVRAFPAA  420
GFTRSNSTHG SQPHTYMQTD QETRPYLSLQ LFGGTEEDIP PKMDSANKYL SSESSNPLDE  480
RSPSSSPPIT HKFFPVHSVD EEDRHPHDYG EDAAMVEVST SRAWCAPPLE LFKDSDRPIE  540
NGSPPNPGYQ SCYASTSCSD HSPSTSNSDG QDRTGRIIFK LFGKEPSTIP GNLRDEIVNW  600
LKHSPTEMEG YIRPGCLVLS MYLSMPAIAW EELEENLLQR VNTLVQNPDL DFWREGRFLV  660
RTDSKLVSYN EGTTRLSKSW RTWNTPELTF VSPIAVVGGQ KTSLILKGRN LTIPGTQIHC  720
TSTGKYISKE VLCSAYPGTI YDDSGVETFD LPGEPDLILG RCFIEVENRF RGNSFPVIVA  780
SSSVCQELRN LEVELEDSQF PDVPSDDQVH DPRQSKPRDQ VLHFLNELGW LFQRAAACTS  840
SSRPDVSDLD LIQFSTPRFK YLLLFSSERD WCSLTKTLLD ILAKRSLVSD ELSQETMEML  900
AEVHLLNRAV KRKSSRMVHL LVKFVVICPD NSKVYPFLPN FPGPGGLTPL HLAASIENAE  960
DIVDALTDDP QQIGLNCWQS VLDDDGQSPE TYAKLRNHNS YNELVAQKLV DKKNSQVSIM  1020
VDKDEIRMDQ SGNIGGVRAL QIQSCSQCAI LESGVLRKPL RSRGLLARPY IHSMLAIAAV  1080
CVCVCVFMRA LLRINSGRSF KWERLDYGTM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-33169252184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.16120.0callus| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG310500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820195.10.0squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLA0A3L6QB900.0A0A3L6QB90_PANMI; Squamosa promoter-binding-like protein 15
STRINGPavir.Fb01917.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14