PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG157500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 133aa    MW: 15341.3 Da    PI: 5.6837
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG157500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK52.78.5e-1793131240
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyG 40 
                          +k+ ++e +s+yFs+pik+AA+eL+v+lTvLKr+CR +G
  Pavir.6NG157500.1.p  93 KKRSTFELVSRYFSMPIKQAARELDVGLTVLKRRCRALG 131
                          677799*******************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.51280133IPR003035RWP-RK domain
PfamPF020425.6E-1297131IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MEELRFNEKG YHYYHGLKLH KDEGYFQLQD FSADYLLGEE THFCAISCPE SSFSQEELVC  60
LSEVDFASFW ALVEEEDARR KSEEGPRSGP GKKKRSTFEL VSRYFSMPIK QAARELDVGL  120
TVLKRRCRAL GAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17894RRKSEEGPRSGPGKKKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG157500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822796.14e-67protein RKD1
TrEMBLA0A3L6RT053e-71A0A3L6RT05_PANMI; Protein RKD3-like
STRINGPavir.J17077.1.p5e-86(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.17e-11RWP-RK domain-containing protein