PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG110800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 465aa    MW: 48441.6 Da    PI: 7.5827
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG110800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.2e-32254307255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pavir.6NG110800.1.p 254 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 307
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15251308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28252308IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23254307IPR006447Myb domain, plants
PfamPF002497.0E-7255306IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEARAASAPD LSLHISLPSS AASPPPAPGR LGAAVGGRGA QPAAGGDPWR RLNGSTASTE  60
LSLSPPPRQE PAGDVLPWRL RPPAANYSSS SSPSSAATAE AASFVPVTVP RLSLDAAAEA  120
ARARPINGVP VYSSPRAAGH PFLGAAGDYR QGHPKVGLYN PYHASSWPSS LRSTTTPPAV  180
APSASDPAAA FLSPSAYHRM LSGTGRLHLH GVLADTFRGY GGHHHRQQQQ HFGSLASARY  240
MPKFPASRRG MRAPRMRWTS SLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS  300
HLQMYRTVKS TDKPETSSGT VIISRGANEW PLGPVDCGGG CGSGDDDLPD AGQAPSAGED  360
ASPQPFTTHQ SASSEGAASH AGGEVECSSA EDSDGGRARS GASSRDQWPP PAACNVDTHR  420
SVEDMEPACG SVGLHQVPNH EMSCHSPSLE SRVGRANWNV PEHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-16255309357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16255309357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16255309357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16255309357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.178220.0root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and flowers. {ECO:0000269|PubMed:18594992}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6NG110800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9350031e-173EU935003.1 Zea mays cultivar B73 kanadi1 (kan1) mRNA, complete cds.
GenBankJX4699821e-173JX469982.1 Zea mays subsp. mays clone UT3342 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820099.10.0probable transcription factor RL9 isoform X1
SwissprotQ0J2357e-81ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6RKZ80.0A0A3L6RKZ8_PANMI; Putative transcription factor RL9
STRINGPavir.Fb00812.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-42G2-like family protein