PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG244900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 130aa    MW: 14056.7 Da    PI: 5.7765
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG244900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK53.83.8e-1775113240
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyG 40 
                          ++ +++e +s+yFs+pik+AA+eL+v+lTvLKr+CR +G
  Pavir.6KG244900.1.p  75 KQGLTFELVSRYFSMPIKQAAQELDVGLTVLKRRCRALG 113
                          6789*********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.64962129IPR003035RWP-RK domain
PfamPF020427.5E-1378114IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
YQIGRFSQHS SADYLLGEET HLCAISCPES SFSQVNAEEL GCLSEVDFAS FWALVEEEDA  60
RRKSEEGPRS GQGKKQGLTF ELVSRYFSMP IKQAAQELDV GLTVLKRRCR ALGTPPAAAA  120
AGPSGRRST*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.6KG244900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822796.12e-53protein RKD1
TrEMBLA0A3L6RT051e-54A0A3L6RT05_PANMI; Protein RKD3-like
STRINGPavir.J14787.1.p1e-68(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-09RWP-RK domain-containing protein