PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG209600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 892aa    MW: 100119 Da    PI: 7.9265
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG209600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP121.93e-38128204278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cqv+gC+adls a++yh+rhkvCe+h++++ v ++++e+rfCqqCsrfh l+efDe+k+sCr+rLakhn rrrk q+
  Pavir.5NG209600.1.p 128 CQVDGCHADLSGARDYHKRHKVCEAHTRTSLVRIKNIEHRFCQQCSRFHLLQEFDEGKKSCRSRLAKHNGRRRKGQP 204
                          **************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-31120189IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.684125202IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-35126205IPR004333Transcription factor, SBP-box
PfamPF031105.4E-29128201IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.4E-5624769IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484036.53E-7624769IPR020683Ankyrin repeat-containing domain
CDDcd002042.63E-7660768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 892 aa     Download sequence    Send to blast
METGFLWKEN GDPAGAARMS GGHKNKSLDW DLNDWRWDAN LFLATPAAAT PSECSSRELS  60
RAQGEIDFGV VVDKRRRLSP EEDGSASCSN NSAVANGDTN HVVSVQRRQS SEEERPRKGA  120
SSSTPPSCQV DGCHADLSGA RDYHKRHKVC EAHTRTSLVR IKNIEHRFCQ QCSRFHLLQE  180
FDEGKKSCRS RLAKHNGRRR KGQPQGVVDG NPTNENQSLS SALFLLLKQL SGLESGSSSE  240
QINHPNYLVN LLKNLAAISS TQAYQDILKN ANSNPISNAG NNAANGSTMH ELTIRSIPVC  300
SESLAEGPPL KKRVQDFDLN DACIEEVESR TDKIVFKLFG KEPKDFPVDL REQILNWLSH  360
CPTDMESYIR PGCVILTIYL RLPNWMWEEL DDDPAPWIEK LISISNDGFW RTGWMYARIQ  420
GSLTLSCNGS LMLASPWQPV IGDRLQRLCV TPIAVDCSST AKFCVQGFNI VQPTTKLLCV  480
FGGKYLIQEE TQMLLEVRSK KQMLLEDTTM QQGPQCLTFS CSFPSTSGRG FIEVEDYDQS  540
NLSVPFVVSG KDVCSEIRML EHELNLSSFD ETSERIGDLM ASRSRALHFL QEFGWLLQRR  600
HVQATSEQRQ YCTEGFSVAR FRWLLSFAID QEWCAVVKKL LNTMFRGDID VSSPIEFALG  660
ENLLVTAVNK RSKPLVQFLL RYRTRNYAPD NRAIDPVQFL FTPDMTGPSN ITPLHIAATI  720
SDATSVLDAL TDDPQQLGIK AWKNARDDTG LTPEDYAQKR GHISYIQMVQ DKIDRRLRKA  780
HVSVAIPSRP SAPDTVRKHG SQLKPTDQTT FNVEKSPRSI NQPMSCRLCV HQVHQLAYRP  840
QPTRLFSTRP AMLSLVAIAA VCVCVGLIMK SPPHVNFMKP FLWEKIRWGP N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-25120201384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17377KRRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.7480.0callus| leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5NG209600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819590.10.0squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_025819591.10.0squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A2S3HWL10.0A0A2S3HWL1_9POAL; Uncharacterized protein
STRINGPavir.Eb01272.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.11e-138squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang H,Zhai J,Mo J,Li D,Song F
    Overexpression of rice sphingosine-1-phoshpate lyase gene OsSPL1 in transgenic tobacco reduces salt and oxidative stress tolerance.
    J Integr Plant Biol, 2012. 54(9): p. 652-62
    [PMID:22889013]
  3. Zhang H, et al.
    Molecular characterization of rice sphingosine-1-phosphate lyase gene OsSPL1 and functional analysis of its role in disease resistance response.
    Plant Cell Rep., 2014. 33(10): p. 1745-56
    [PMID:25113543]