PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG066400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 490aa    MW: 52239.2 Da    PI: 5.8329
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG066400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31267322156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pavir.5NG066400.1.p 267 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 322
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.554264324IPR017930Myb domain
SuperFamilySSF466893.29E-17265325IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-28265325IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-26267322IPR006447Myb domain, plants
PfamPF002491.1E-6269320IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MASSPSDLTL DYKPNGNGGG GGGTYAVIPK QQEPLVDGHH LTTTEQTTQK LREFLARLEE  60
ERLKIDAFKR ELPLCMHLLN YAMEAYRQQL EAYQMGSLQG APARPLVLEE FIPLKNIGMD  120
AAADKMRNAP SEKASWMESA QLWNGPGAAA APPDTAAKGP QTPKESSEHP LPIDTLGALD  180
AGAGLRNGGA FLPFGKDKAA AEGAALLEIA LAPAEKDAGE ADRKPYLDAA GANGGLGARR  240
DLQNGAKPAS NGPDGQAPPH PPQPHRKARR CWSPELHRRF VNALQILGGA QVATPKQIRE  300
LMKVDGLTND EVKSHLQKYR LHTRRPMPPP PAPATAAPQL VVLGGIWVPP EYATQAAGQA  360
IYGAHPATQP HYTAAVAAAA AQEYYPPHAA VHHLQHHPGA MTMHRAAAPP PTPQAAYKAA  420
MASSPPESSE GRGSAGEQRR REERSESIDE EDEGEDREDD DDDDDVPAAK PAGEESAAPR  480
RSSTDQEFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13267320154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13267320154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13267320154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13267320154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5NG066400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865721e-178BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819732.10.0transcription factor NIGTH1
SwissprotQ5VRW21e-147NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A3L6SLE00.0A0A3L6SLE0_PANMI; Putative transcription factor GLK2
STRINGPavir.Eb00363.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-43G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]