PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG007800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 936aa    MW: 102671 Da    PI: 6.1073
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG007800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29588639152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Pavir.5NG007800.1.p 588 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 639
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.746578659IPR003035RWP-RK domain
PfamPF020423.3E-26591639IPR003035RWP-RK domain
SuperFamilySSF542771.31E-20831926No hitNo description
SMARTSM006664.1E-24841923IPR000270PB1 domain
PfamPF005644.4E-16841922IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.5E-25841922No hitNo description
PROSITE profilePS5174519.753841923IPR000270PB1 domain
CDDcd064073.76E-32842922No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MDLDPPTSGP GDACAVSADA WPFDSLTSSL LFPSVSASPP LPPLPANSSS WLTPPSPLWF  60
FEDRHLLPLD APQAPEATVA AAVVEEVQRA RSGNSDSTSK RVEQINHKWQ FHLSLDEDGT  120
DNSSLFKERL TQALRYFKDS TDQHLLVQVW APVKNGDRYV LTTSGQPFVL DHQSIGLLQY  180
RAVSMMYMFS VDGENVGELG LPGRVYKLKV PEWTPNVQYY SSTEFPRLNH AISYNVHGTV  240
ALPVFDPSAQ SCIAVVELIM TSKKINYACE VDKVCKALEA VNLKSTEILD HPNVQICNEG  300
RQTALVEILE ILTVVCEEHK LPLAQTWVPC KYRSVLAHGG GLKKSCLSFD GSCMGEVCMS  360
TSDVAFHVID AHMWGFRDAC VEHHLQRGQG VSGKAFITRK PCFSKDIRKF CKLKYPLVHY  420
ARMFGLAGCF AICLQSSYTG RDDYILEFFL PPDCIDEHDQ NALLESIFTL MKQCLRSLKV  480
VGDRDSSGVS LQLSNVLKIE NEEFKTDAQF DNSDGSLHES PKGDTHGGAH TFDNGDNNVP  540
NLPEGHLMAD DCSQDNGTSV GRPNGSGASD SLVLPKTSKP PERRRGKAEK TISLEVLQQY  600
FSGSLKNAAK SLGVCPTTMK RICRQHGISR WPSRKINKVN RSLSKLKQVI ESVQGSDAAF  660
NLTSITGPLP IPVGPSSDSL NVEKVTQNKV AEPSNLVVDG DRDSSLQKSL ENDGHFSILM  720
AQQGFIDNNN DSQLEADKAS RSRSSSGEGS INSRTSEGSC QGSPANRTFV CKPIASTFAE  780
PQLNPEEFHK EHFQEPQLPL SRMLIEDSGS SKDLKNLFTP AADQPFLAPP SNLVSMKHSG  840
TVTIKASFKE DIVRFRFPCS GSITVLKNEV AKRLRMDVGT FDIKYLDDDH EWVKLACNAD  900
LEECMEISRN SGSDVIRLLV SDITAHLGSS CGSSG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.50840.0callus| leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5NG007800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814939.10.0protein NLP3 isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A2T7DTG50.0A0A2T7DTG5_9POAL; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7