PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG740800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 382aa    MW: 39923.3 Da    PI: 9.2074
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG740800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.43.7e-4286162278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C vegC+adls+ ++yhrrhkvCe+hsk+pvv+v+g++qrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+q+
  Pavir.5KG740800.1.p  86 CSVEGCAADLSKGRDYHRRHKVCEAHSKTPVVTVAGQQQRFCQQCSRFHSLGEFDDTKRSCRKRLDGHNRRRRKPQP 162
                          **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3478147IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.89883160IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-3984165IPR004333Transcription factor, SBP-box
PfamPF031101.0E-3186159IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDWDAKMLPP WDLGTVVGPS SGVGVVAAAG ASGGGGALDL KLGGPTSWRA GAATAPAAAP  60
LPPRPSSSAP AKRPRAGQAQ QAVPACSVEG CAADLSKGRD YHRRHKVCEA HSKTPVVTVA  120
GQQQRFCQQC SRFHSLGEFD DTKRSCRKRL DGHNRRRRKP QPDPLNPGGL FADNHGVARF  180
TSYPQLFASS MADPKWPVVK TEADIFQDHY YPAVHLNGAG SLFHGQDRKH LPFLTNHHHG  240
GDAAGAFASQ PFTITTASSE SSSKHSNGNC ALSLLSDNPT RAQTTTMIPT AQPLGAALQY  300
GGAARLPDGG DVSLTGMSYA NARAGDSKHP SILSTSTNHT AVASPSPGAQ LQYHGYYHVS  360
GGDQGNNPDG AAIQAIPFSS W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29861591184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142159KRSCRKRLDGHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5KG740800.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814120.10.0squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-117SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLA0A2T7DCF30.0A0A2T7DCF3_9POAL; Uncharacterized protein
STRINGPavir.Ea03909.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-31SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]