PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG681300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 439aa    MW: 46846.9 Da    PI: 7.7971
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG681300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.5e-50631882128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                          +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ 
  Pavir.5KG681300.1.p  63 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRM 151
                          79***************************.89***************888889************************************* PP

                  NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          + +++++++glkktLvfy+g+apkg++++W+m+eyrl
  Pavir.5KG681300.1.p 152 IRAENQRAIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 188
                          ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.60662209IPR003441NAC domain
SuperFamilySSF1019411.02E-5563208IPR003441NAC domain
PfamPF023651.1E-2464188IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MRGRQGEGEG ERGAAVDDRP AMSGRHEHGH GAAAAAAGGG GGGWAADGGG GGGDDEHEDD  60
LVMPGFRFHP TEEELIEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAM AAIGEKEWFF  120
YVPRDRKYRN GDRPNRVTAS GYWKATGADR MIRAENQRAI GLKKTLVFYS GKAPKGVRSS  180
WIMNEYRLPP DDTDRYQKTE ISLCRVYKRT GIDDGHGHPS ARSTPSRRAA AQQDIKQASS  240
SSTPTPPTTP SKIMHLLHGE CTSPPATRDH AAAHNTAAAA AAAQRQLPTK PCNGGYQLSA  300
TTSSAAASAG ADQQQVGTAA MPSSSYEQSR NVNAFAASTY SLLSLVNAAS MGGGSAAAAI  360
DELSTLVGHG PPAYFNNHQA GGGHSHSFLP LPTPSPQPMA LGTLPTMSLA TISDKIWDWN  420
NPNPDAAARD YYSSAGFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-546420919165NO APICAL MERISTEM PROTEIN
1ut4_B4e-546420919165NO APICAL MERISTEM PROTEIN
1ut7_A4e-546420919165NO APICAL MERISTEM PROTEIN
1ut7_B4e-546420919165NO APICAL MERISTEM PROTEIN
4dul_A4e-546420919165NAC domain-containing protein 19
4dul_B4e-546420919165NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5KG681300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0398640.0BT039864.1 Zea mays full-length cDNA clone ZM_BFc0047I12 mRNA, complete cds.
GenBankEU9571310.0EU957131.1 Zea mays clone 1583712 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970843.10.0NAC domain-containing protein 35
TrEMBLA0A2T7DDD80.0A0A2T7DDD8_9POAL; Uncharacterized protein
STRINGPavir.Ea03596.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-100NAC domain containing protein 35