PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG658900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 395aa    MW: 41366.9 Da    PI: 11.6873
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG658900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.8e-14313361452
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                           +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN +L  e ee 
  Pavir.5KG658900.1.p 313 MQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLREQEER 361
                          68*************************************9987766543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-8310372IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76312360IPR004827Basic-leucine zipper domain
PfamPF001707.4E-14313369IPR004827Basic-leucine zipper domain
CDDcd147071.54E-18314364No hitNo description
SuperFamilySSF579592.38E-10315362No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-13315370No hitNo description
PROSITE patternPS000360317332IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MAINSPVPSS MPPVAGRASV TTPPTSESAL GPSRERTART PSLPHVSSTS SLPSSLAFRV  60
LASQPTNHRL RLPKPRPPPL REQSCREEKK KKNNPTEGTR ARRGRGRGGG PGRGRGGGRG  120
AKRMASSRVM PSSSPSHTAS DLARLAQAAS RPGGGGGSGL GSMNVEELLR GIYGDMPTPA  180
TPAPAAGRPM PQAPPPAPGI AARKTAEQVW KEITTRGGSA GTAAPVPQAV VPAGAGGGAG  240
AGVPEMTLED FLAREGAVKE DEVRISGPSA PAEGQVAMGF LGGAEGVGVA GAGGGGGRGR  300
KRQLMDPVDR GAMQRQKRMI KNRESAARSR ERKQAYIAEL ESLVTQLEEE NAELLREQEE  360
RHQKRLKELL ERVTPVIVRK KPSQDPRRTN SMQW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.111899e-66callus| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5KG658900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816287.11e-125bZIP transcription factor 12
SwissprotQ0JHF14e-97BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A2S3HPN11e-123A0A2S3HPN1_9POAL; Uncharacterized protein
STRINGPavir.Ea03718.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-19G-box binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]