PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG658900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 395aa    MW: 41366.9 Da    PI: 11.6873
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG658900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.8e-14313361452
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                           +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN +L  e ee 
  Pavir.5KG658900.1.p 313 MQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLREQEER 361
                          68*************************************9987766543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-8310372IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76312360IPR004827Basic-leucine zipper domain
PfamPF001707.4E-14313369IPR004827Basic-leucine zipper domain
CDDcd147071.54E-18314364No hitNo description
SuperFamilySSF579592.38E-10315362No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-13315370No hitNo description
PROSITE patternPS000360317332IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MAINSPVPSS MPPVAGRASV TTPPTSESAL GPSRERTART PSLPHVSSTS SLPSSLAFRV  60
LASQPTNHRL RLPKPRPPPL REQSCREEKK KKNNPTEGTR ARRGRGRGGG PGRGRGGGRG  120
AKRMASSRVM PSSSPSHTAS DLARLAQAAS RPGGGGGSGL GSMNVEELLR GIYGDMPTPA  180
TPAPAAGRPM PQAPPPAPGI AARKTAEQVW KEITTRGGSA GTAAPVPQAV VPAGAGGGAG  240
AGVPEMTLED FLAREGAVKE DEVRISGPSA PAEGQVAMGF LGGAEGVGVA GAGGGGGRGR  300
KRQLMDPVDR GAMQRQKRMI KNRESAARSR ERKQAYIAEL ESLVTQLEEE NAELLREQEE  360
RHQKRLKELL ERVTPVIVRK KPSQDPRRTN SMQW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.111899e-66callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458823.11e-115hypothetical protein SORBIDRAFT_03g040970
TrEMBLA0A0A9RIT51e-118A0A0A9RIT5_ARUDO; Uncharacterized protein
STRINGSb03g040970.11e-115(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-19G-box binding factor 4