PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG363000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 330aa    MW: 36465.5 Da    PI: 7.3694
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG363000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK86.42.6e-27177226352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++i +++l+kyF++pi+ AA+eL+v+lTvLK++CR++GI+RWPhRk+ksl
  Pavir.5KG363000.1.p 177 DHIGFDELRKYFYMPITRAARELNVGLTVLKKRCRELGIARWPHRKMKSL 226
                          6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.973166247IPR003035RWP-RK domain
PfamPF020424.3E-22179226IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAPCCGDGGR DDDCWYQQYG LDDFPPLCPA PPPPLALLRS PYYFSDQLPP VPVDGATVGL  60
DDALLLPLGD IDLEAFDNAD DNKEAIVPAG QHSGGHEYAG VDVVHADQKP IATAIADSFR  120
PRAIAFEATM RRHGEHKKSS SVAALVLPPP PPSLPPPRGR RSVDHRSALA QGKTRLDHIG  180
FDELRKYFYM PITRAARELN VGLTVLKKRC RELGIARWPH RKMKSLKSLI LNVQEMGTGM  240
NPAAVQQELA ALETYCALME ENPAIELTER TKKLRQACFK ESYKRRRAAA VNVVDHLFSF  300
DDHKYRHQLP PPPTSSTEQH GHGSSFFGY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5KG363000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039336e-63AP003933.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0066C06.
GenBankAP0042586e-63AP004258.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0024F24.
GenBankAP0149576e-63AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126096e-63CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025815472.11e-157uncharacterized protein LOC112892548
TrEMBLA0A2T7DL101e-173A0A2T7DL10_9POAL; Uncharacterized protein
STRINGPavir.Eb01347.1.p1e-170(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-36RWP-RK domain-containing protein