PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG267000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 315aa    MW: 33061.8 Da    PI: 9.9984
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG267000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.2e-4177153177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  Pavir.4NG267000.1.p  77 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAAGGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 153
                          6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.3E-3570139IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.49675152IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-3976154IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3178151IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MPGDVYPALG LVKREGGGVG ADGGAGAAGG GRIGLNLGRR TYFSPGDMLA VDRLLMHSRL  60
GGVFGLGFGG AHHRPPRCQA EGCKADLSGA KHYHRRHKVC EYHAKASVVA AGGKQQRFCQ  120
QCSRFHVLTE FDEAKRSCRK RLAEHNRRRR KPAAASTASS KDAAASPPAK KPSGGSMTGS  180
YTTDSRNLST AKSTMSSNTG SVISCLDQGN KQLARPTLTL GASPDKDHQH QQFSTMLQVQ  240
AAAGGHHQEQ HFITSLQVHN HNNGGGGGGN NNILSCSSVC SSALPSANGE VSDQNTTTTN  300
GNGNMHNLFE VDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-30781511184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134151KRSCRKRLAEHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.4NG267000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116170.0AJ011617.1 Zea mays mRNA for SBP-domain protein 4.
GenBankBT0339370.0BT033937.1 Zea mays full-length cDNA clone ZM_BFc0033O21 mRNA, complete cds.
GenBankBT0342980.0BT034298.1 Zea mays full-length cDNA clone ZM_BFc0007A11 mRNA, complete cds.
GenBankBT0657120.0BT065712.1 Zea mays full-length cDNA clone ZM_BFc0041B17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.11e-180squamosa promoter-binding-like protein 10
SwissprotA2YFT91e-100SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-100SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLK3XXA11e-178K3XXA1_SETIT; Uncharacterized protein
STRINGPavir.Db00525.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.19e-45squamosa promoter binding protein-like 8