PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG100700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 287aa    MW: 32508.1 Da    PI: 8.1248
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG100700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.79.8e-28156206252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          e  +++e +s+yF++pi +AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  Pavir.4NG100700.2.p 156 ETALTFELVSQYFYMPIMQAARELNVGLTLLKKRCRELGIPRWPHRKMKSL 206
                          6789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.156143226IPR003035RWP-RK domain
PfamPF020426.5E-22159206IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MCPMISGFMG RISLPSSPYN CWPASNSSIS HSPGRMEANH EESCLLPYWT SAWAGSNLLE  60
EEALLSSLSF PSLHFQPSYS TITPSNILQD ELDAIFKDDV LKHWDEMERA DSKAEDGGHK  120
RLPLLCYGDE KDVFSGSNSG ATKVAGADQR ARPPEETALT FELVSQYFYM PIMQAARELN  180
VGLTLLKKRC RELGIPRWPH RKMKSLQSLI NNVQVLQEAG KATGEEQLRA VVEMLQQEKQ  240
LLEQRPYVQL EKKTKRLRRA CFKANYKKRR LLALEGEEAT RTTHKY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.4NG100700.2.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966836.11e-138protein RKD2
TrEMBLA0A3L6RY281e-146A0A3L6RY28_PANMI; Protein RKD2
STRINGPavir.J13146.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-38RWP-RK domain-containing protein