PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG100700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 288aa    MW: 32579.2 Da    PI: 8.1248
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG100700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.79.8e-28157207252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          e  +++e +s+yF++pi +AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  Pavir.4NG100700.1.p 157 ETALTFELVSQYFYMPIMQAARELNVGLTLLKKRCRELGIPRWPHRKMKSL 207
                          6789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.156144227IPR003035RWP-RK domain
PfamPF020426.5E-22160207IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MCPMISGFMG RISLPSSPYN CWPASNSSIS HSPGRMEANH EESCLLPYWT SAWAGSNLLE  60
EEALLSSLSF PSLHFQPSYS TITPSNILQA DELDAIFKDD VLKHWDEMER ADSKAEDGGH  120
KRLPLLCYGD EKDVFSGSNS GATKVAGADQ RARPPEETAL TFELVSQYFY MPIMQAAREL  180
NVGLTLLKKR CRELGIPRWP HRKMKSLQSL INNVQVLQEA GKATGEEQLR AVVEMLQQEK  240
QLLEQRPYVQ LEKKTKRLRR ACFKANYKKR RLLALEGEEA TRTTHKY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.4NG100700.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966836.11e-136protein RKD2
TrEMBLA0A3L6RY281e-147A0A3L6RY28_PANMI; Protein RKD2
STRINGPavir.J13146.1.p1e-176(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-38RWP-RK domain-containing protein