PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG027600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 614aa    MW: 65005.8 Da    PI: 6.516
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG027600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.21.9e-1182225912374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsP 89 
                          v +L+ cA+ +s++++ +a+ +Larl e+asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ ++al++++ ++P
  Pavir.4NG027600.1.p 222 VVALTGCADSLSARNHDAANYYLARLGEMASPAGpTPMHRVAAYFAEALALRVVRTWPHLFDVTPPRELADGAvGDDDATALRILNAITP 311
                          5689****************************************************************9988878999************ PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          i++f h+t N+ +l+a++g++rvH+iD+di+qGlQWp Llq+La+R+ +p+++RiTgvg+    s++el+etg rL ++A++lg+ fef+
  Pavir.4NG027600.1.p 312 IPRFLHFTLNERMLRAFDGHDRVHVIDLDIKQGLQWPGLLQSLATRATPPAHVRITGVGE----SRQELQETGARLGRVAAALGLAFEFH 397
                          ************************************************************....9************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + v++rled++l++L+vk+gE++aVn+vl+ hrll++++  +    ++L l +s+ + ++ + e+e  +ns+++ +rf++al+yy+a fd
  Pavir.4NG027600.1.p 398 A-VVDRLEDVRLWMLHVKRGECVAVNCVLAAHRLLRDDTGAAL--ADFLGLARSTGAAILLLGEHEDALNSGRWEARFARALRYYAAAFD 484
                          *.7********************************87777666..89******************************************* PP

                 GRAS 270 sl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee..sg 356
                          ++ +a+l+ +s +r+k E++ ++rei+n+va e a+r+erhe+++ Wr+r+ee GF+++ l++++a+qa+++ r+++   y+v+ +   +
  Pavir.4NG027600.1.p 485 AVgAAGLSDASPARVKAEEM-FAREIRNAVAFEDADRFERHESFAGWRRRMEEGGFQNAGLGDREAMQARMIARMFAPGNYSVQAQgdGE 573
                          **99****************.********************************************************555*999554367 PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                           l+l W d+p+++vSaW+
  Pavir.4NG027600.1.p 574 GLTLRWLDQPMYTVSAWT 591
                          788**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.057195569IPR005202Transcription factor GRAS
PfamPF035146.6E-116222591IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MLAGCSFSSS RHQMSTAQRF DILPCGFSKR SNRGDGGAAP RVAAGDPRTG GGGATCSFRT  60
HPAPPVTQAV SWGAKPEPGG NGAGGVWERS SRAVKRAHEE DAGEEYGGPV VRAKRTRMGG  120
DGDEVWFHQP IAGTVQAAGG GEGEEPEEEK VFLVPSAAAF PHAGPSLVAA KKEEFSKSPS  180
NSPASSGGTD GGSSAVPPPP ELHARNGVPA RGEAGREAME LVVALTGCAD SLSARNHDAA  240
NYYLARLGEM ASPAGPTPMH RVAAYFAEAL ALRVVRTWPH LFDVTPPREL ADGAVGDDDA  300
TALRILNAIT PIPRFLHFTL NERMLRAFDG HDRVHVIDLD IKQGLQWPGL LQSLATRATP  360
PAHVRITGVG ESRQELQETG ARLGRVAAAL GLAFEFHAVV DRLEDVRLWM LHVKRGECVA  420
VNCVLAAHRL LRDDTGAALA DFLGLARSTG AAILLLGEHE DALNSGRWEA RFARALRYYA  480
AAFDAVGAAG LSDASPARVK AEEMFAREIR NAVAFEDADR FERHESFAGW RRRMEEGGFQ  540
NAGLGDREAM QARMIARMFA PGNYSVQAQG DGEGLTLRWL DQPMYTVSAW TPVGDGGGGG  600
STVSASVSTT GQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4125859039374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.180180.0root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0028380.0AP002838.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0038F22.
GenBankAP0011680.0AP001168.1 Oryza sativa Japonica Group genomic DNA, chromosome 6, clone:P0425F02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.10.0PREDICTED: scarecrow-like protein 28
TrEMBLK3Y2010.0K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-122GRAS family protein