PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG364200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 358aa    MW: 37340.8 Da    PI: 10.3056
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG364200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.5e-4181157177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cq+egC+adls ak+yhrrhkvCe h+ka+vv+++g++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  Pavir.4KG364200.1.p  81 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAAAGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 157
                          6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-3574143IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.4779156IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-3980160IPR004333Transcription factor, SBP-box
PfamPF031103.6E-3182155IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MPMPLPGMPG DVYPALGMVK REGADGGGGA AGGGGRIGLN LGRRTYFSPG DMLAVDRLLM  60
RSRLDGVFGL GFGGAHHQPP RCQAEGCKAD LSGAKHYHRR HKVCEYHAKA SVVAAAGKQQ  120
RFCQQCSRFH VLTEFDEAKR SCRKRLAEHN RRRRKPAAST ASSKDGASPP AKKPCGGSMT  180
GSYTTDSKNL STAKSTMSSN TGSVISCLDQ GNKQQLARPT LTLGASLDKD HQHQQQLSTM  240
LQAQAAAGGG HHHHHHHHPE QHFITSLQVH SHNNGGGGGG GGNNNILSCS SVCSSALPPA  300
NGGEVSDQNT TNGNGNGNGA AACTICSRWT SCRPYVGVRA KRASTGVRSS GKGVLGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29821551184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138155KRSCRKRLAEHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.4KG364200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116160.0AJ011616.1 Zea mays mRNA for SBP-domain protein 3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.11e-159squamosa promoter-binding-like protein 10
SwissprotA2YFT92e-90SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE82e-90SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLK3XXA11e-157K3XXA1_SETIT; Uncharacterized protein
STRINGPavir.Da00293.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-50squamosa promoter binding protein-like 8