PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG237900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 642aa    MW: 70927.7 Da    PI: 5.118
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG237900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.42.7e-35180254276
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                          Cqv+gCead+ e+k yhrrh+vC  +++a++vl++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  Pavir.4KG237900.2.p 180 CQVPGCEADIRELKGYHRRHRVCLRCAHASAVLLDGVQKRYCQQCGKFHVLLDFDEDKRSCRRKLERHNKRRRRK 254
                          ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.8E-27177241IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.581177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-33178258IPR004333Transcription factor, SBP-box
PfamPF031106.0E-27180254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MDAADSGGGA AADAGEPLWD WGNLLDFVQD DDSLVLPWDN AAGIGASDPT EAVAPMLPAP  60
LSQPSEPEPE LQPELEPEPE AEPGPVLPPP PLRVQGIGRR VRKRDPRLVC PNYLAGRVPC  120
ACPEVDEMVA AAEVEDVATE FLAGARKKTK TAARRGKAGA AGGGGTAGGT VRAAGMEMKC  180
QVPGCEADIR ELKGYHRRHR VCLRCAHASA VLLDGVQKRY CQQCGKFHVL LDFDEDKRSC  240
RRKLERHNKR RRRKPDSKGM LDKEIDEQLD LSADVSGDGE LREENMEGTT SEMLETVLSN  300
KVLDRGTPAG SEDVLSSPTC TQPSLQNEQS KSVVTFAASV EACIGAKQEN AKLTTNSPMH  360
DTKSAYSSSC PTGRISFKLY DWNPAEFPRR LRHQIFEWLA SMPVELEGYI RPGCTILTVF  420
VAMPQHMWDK LSDDAANLLR NLVNSPNSLL LGKGAFFIHV NNMIFQVLKD GATLMSTRLD  480
VQSPRIDYVH PTWFEAGKPV ELMLCGNFLD QPKFRSLLSF DGDYLKHDCY RLTSRDAIDC  540
AENVDLILDS QHEFFRINIT QTRPEIHGPA FVEVSIIFFD NLDQIPSLNF CYGHLPLEFM  600
VNLIVLKAWC GESIIKYTGE CLSAFREGFF FLSFFCNLPS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A9e-38175259185squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236254KRSCRRKLERHNKRRRRKP
2240252RRKLERHNKRRRR
3247254NKRRRRKP
4248253KRRRRK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.4KG237900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805456.10.0squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A3L6T0780.0A0A3L6T078_PANMI; Squamosa promoter-binding-like protein 9
STRINGPavir.J00965.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-113squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]