PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG199600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 253aa    MW: 28899.1 Da    PI: 7.0098
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG199600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK888e-28121171252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          e  +++e +s+yF++pi +AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  Pavir.4KG199600.1.p 121 ETALTFELVSQYFYMPIMQAARELNVGLTLLKKRCRELGIPRWPHRKMKSL 171
                          6789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.747108191IPR003035RWP-RK domain
PfamPF020425.3E-22124171IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MEANHEESSC LLPYWTSAWA GSDLLEEDAL FSSLSFPSLH FQPSYSTIIT PSNILQDELD  60
AIFKDDVLKH WDEMERAGCK AEDGHKRSPL LCYGEEKEVS SGSDPGAEVA RACRRARPPE  120
ETALTFELVS QYFYMPIMQA ARELNVGLTL LKKRCRELGI PRWPHRKMKS LQSLINNVQV  180
LQEAGKATGE EQLRAVVEML QQEKQLLEQR PYVQLEEKTK RLRQACFKAN YKKRRLLALE  240
AGEAPRRITP KY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.4KG199600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966836.11e-137protein RKD2
TrEMBLA0A3L6RY281e-147A0A3L6RY28_PANMI; Protein RKD2
STRINGPavir.Da01160.1.p1e-179(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-39RWP-RK domain-containing protein