PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG317000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 630aa    MW: 68594.3 Da    PI: 5.7937
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG317000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS37.14.5e-123123661064
                 GRAS  10 eavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal 64 
                          eav+++d + a++lL++++ +as +gd+mqRla +f+e+L+arla+++s+++   
  Pavir.3NG317000.1.p 312 EAVATDDRRGATELLKQIERHASAHGDAMQRLARCFAEGLQARLAGTGSSTSTPP 366
                          699*******************************************887777543 PP

2GRAS152.92.9e-47400599128333
                 GRAS 128 LlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlld 215
                          Llq    R++gpp++RiTg++ p++g   ++++eetg+rL+++A+e+gvpf+++vl+a+r+e+++ e+L+++p+E+l+Vn+++q ++l+d
  Pavir.3NG317000.1.p 400 LLQPDHPRRGGPPEVRITGINLPQPGfrPAQRVEETGRRLSSYAQEFGVPFRYQVLAASRMETIRAEDLNLDPEEVLIVNCIFQFENLMD 489
                          555556799****************9**************************************************************** PP

                 GRAS 216 esvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacega 303
                          esvs+es  +rd  Lk + +++P+ +++   + + +++ F++rf eal +ysal ds+          r+ +E+ ++gr++ nv+aceg+
  Pavir.3NG317000.1.p 490 ESVSMESpsPRDVALKNIGRMRPHAFIHGVVNGSFSAPFFATRFREALFHYSAL-DST---------RRMLIEENIFGRAALNVIACEGT 569
                          ******9989*****************************************985.543.........6789******************* PP

                 GRAS 304 errerhetlekWrerleeaGFkpvplseka 333
                          +r+er et+++W+ r ++aG+k++pl+ ++
  Pavir.3NG317000.1.p 570 DRVERPETYRQWQVRNQRAGLKQLPLNPTT 599
                          *************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098529.154277620IPR005202Transcription factor GRAS
PfamPF035141.6E-9312366IPR005202Transcription factor GRAS
PfamPF035141.0E-44400599IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MCSSYDRSPS RGAVADDLSF YLDLPPIPQQ CHQPNCRAAE SPEDMVLPFI SRMLMEEDID  60
DKFFYEYPDH PALLQAQQPF LDILSDDASS SPSAARSGAS VTHPSTSSPN AADAPLHPAA  120
AVDCDAQFNG FDLDPAFFFS GGANSDLMSS AFLKGMEEAN RFLPSQDKLV IDPDPPDDAK  180
RFRFLRPAEN KQLAASGFNA AAPAAAVAVE VEEAVVAAPG GGVGGRGRKN RFDDDEDDLE  240
MHRRSSKQSA LQGDGDVFDK QHMITSQQMC VLVEQMEKLR IPTQEEAAAK KAAAAGGKAK  300
AKGGGGRRVG REAVATDDRR GATELLKQIE RHASAHGDAM QRLARCFAEG LQARLAGTGS  360
STSTPPLMPK QRTPVVDMLQ GPGVPAVHGR HLLQEGLLPL LQPDHPRRGG PPEVRITGIN  420
LPQPGFRPAQ RVEETGRRLS SYAQEFGVPF RYQVLAASRM ETIRAEDLNL DPEEVLIVNC  480
IFQFENLMDE SVSMESPSPR DVALKNIGRM RPHAFIHGVV NGSFSAPFFA TRFREALFHY  540
SALDSTRRML IEENIFGRAA LNVIACEGTD RVERPETYRQ WQVRNQRAGL KQLPLNPTTV  600
QGWKGRILYA ISTWVANDAA AAAAGSCCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-1431359614329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126206e-43CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
GenBankAP0149686e-43AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448786e-43AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724256e-43AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1219436e-43AK121943.1 Oryza sativa Japonica Group cDNA clone:J033107F03, full insert sequence.
GenBankAK1115226e-43AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLA0A096SPI30.0A0A096SPI3_MAIZE; Uncharacterized protein
STRINGGRMZM2G159475_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.16e-86GRAS family protein