PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG316700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 681aa    MW: 74569.3 Da    PI: 5.8827
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG316700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.31.3e-963166511333
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl+cA+av+++d + a++lL++++ +as +gd+mqRla +f+e+L+arla+++s+++   p  +++++ +++ l+a++l+  +  +
  Pavir.3NG316700.1.p 316 LRTLLLHCAQAVATDDRRGATELLKQIERHASAHGDAMQRLARCFAEGLQARLAGTGSSTSTP-PLMPKQRTPVVDMLQAYQLYMAAICF 404
                          6789***************************************************77777743.444444456***************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k  +l  Nq+I  a  g++++Hi+D++i +GlQWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+++A+e+gvpf++
  Pavir.3NG316700.1.p 405 KKAFYLFSNQTIHAASLGKKKIHIVDYGIHYGLQWPCFLRRMACREGGPPEVRITGIDLPQPGfrPAQRVEETGRRLSSYAQEFGVPFRY 494
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          +vl+a+r+e+++ e+L+++p+E+l+Vn+++q ++l+desvs+es  +rd  Lk + +++P+ +++   + + +++ F++rf eal +ysa
  Pavir.3NG316700.1.p 495 QVLAASRMETIRAEDLNLDPEEVLIVNCIFQFENLMDESVSMESpsPRDVALKSIGRMRPHAFIHGVVNGSFSAPFFATRFREALFHYSA 584
                          *******************************************9989******************************************* PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                          lfd l+++ pr+s +r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ ++
  Pavir.3NG316700.1.p 585 LFDVLDETTPRDSTHRMLIEENIFGRAALNVIACEGTDRVERPETYRQWQVRNQRAGLKQLPLNPTT 651
                          *****9999*****************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.839290672IPR005202Transcription factor GRAS
PfamPF035144.6E-94316651IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MCSSYDRSPS RGAVADDLSF YLDLPPTPLQ CHQPNCRAAE SPEDMVLPFI SRMLMEEDID  60
DKFFYEYPDH PALLQAQQPF LDILSDDASS SPSAAGSGAS VTHPSTSSPN AADAPLHPAA  120
AVDCDAQFNG FDLDPAAFFS GGANSDLMSS AFLKGMEEAN RFLPSQDKLV IDPDPPDDAK  180
RFRFLRPAEN KQLAASGFDA AAPAAAVAVE VEEAVVAAPG GGVGGRGRKN RFDDDEDDLE  240
MHRRSSKQSA LQGDGDVFDK QHMITSQQMC VLVEQMEKLR IPTQEEAAAK KAAAAGGKAK  300
AKGGGGRRVG REVVDLRTLL LHCAQAVATD DRRGATELLK QIERHASAHG DAMQRLARCF  360
AEGLQARLAG TGSSTSTPPL MPKQRTPVVD MLQAYQLYMA AICFKKAFYL FSNQTIHAAS  420
LGKKKIHIVD YGIHYGLQWP CFLRRMACRE GGPPEVRITG IDLPQPGFRP AQRVEETGRR  480
LSSYAQEFGV PFRYQVLAAS RMETIRAEDL NLDPEEVLIV NCIFQFENLM DESVSMESPS  540
PRDVALKSIG RMRPHAFIHG VVNGSFSAPF FATRFREALF HYSALFDVLD ETTPRDSTHR  600
MLIEENIFGR AALNVIACEG TDRVERPETY RQWQVRNQRA GLKQLPLNPT TVQGWKGRIL  660
YAISTWVAND AAAAAGSCCF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-393206488329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLA0A096SPI30.0A0A096SPI3_MAIZE; Uncharacterized protein
STRINGGRMZM2G159475_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-130GRAS family protein