PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG316400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 728aa    MW: 80010.2 Da    PI: 5.0665
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG316400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.32.1e-1123467171373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+av+++d + a++lL++++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts   +++ l+a++l+  +  +
  Pavir.3NG316400.1.p 346 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---VVDILQAYQLYMAAICF 432
                          6789************************************************************999999...***************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k+ ++  Nq+I++a  g++++Hi+D++i +G+QWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+k+A+e+gvpf++
  Pavir.3NG316400.1.p 433 KKVVFIFSNQTIYNASLGKKKIHIVDYGIHYGIQWPCFLRRIACREGGPPEVRITGIDFPQPGfrPTQRIEETGRRLTKYAQEFGVPFKY 522
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +vl+a+++e+++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd  L+ +++++P+ +++   + + +++ F++rf eal yysalf
  Pavir.3NG316400.1.p 523 QVLAASKMETIRAEDLNLDPEEVLIVNCIYQFKNLMDESVLIESPRDVALNNIRKMRPHAFIHGIVNGSFSAPFFVTRFREALFYYSALF 612
                          ****************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d l+++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++ G+k++pl+ ++++ ++  +++++ + + ++ ++++l
  Pavir.3NG316400.1.p 613 DVLDTTTPRDSNQRMLIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRTGLKQLPLNPNIMQVVRDKVKECYHKDFVIDIDHHWL 702
                          *****************************************************************************889********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L+++S W
  Pavir.3NG316400.1.p 703 LQGWKGRILYAISTW 717
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.021320698IPR005202Transcription factor GRAS
PfamPF035147.4E-110346717IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MDSSYDPSPS PGAGADDLAF YLSDLGPASP SAYLDLPPTP QHEKPQQQQQ YPQPNGGAAA  60
APEDMVLPFI SRMLMEEDID DKFFYEYPDH PALLQAQQPF LDILSDDASS SSPSAARSGS  120
GASVTHPSTS SSDAASTDAA DAANAPLTPA AVDSYPQFNG FDLDPAAFFS GGANSDLMSS  180
AFLKGMEEAN KFLPSQDKLV IDLDPPDDAK SFVLPAENKL AAAGFNGAAP VAAVAVKVEE  240
AVVAAPDAVP GGGVGGRGRK NRFDDDEEDL EMDRRSSKQS ALQGDGDDRD VFDKYMITSH  300
EMCVEQMEKL RIAMQEEAAK KDAAAGGGNA KAKGGGRRGG REVVDLRTLL IHCAQAVATD  360
DRRSATELLK QIKQHASPQG DATQRLAHCF AEGLQARLAG TGSMVYQSLM AKRTSVVDIL  420
QAYQLYMAAI CFKKVVFIFS NQTIYNASLG KKKIHIVDYG IHYGIQWPCF LRRIACREGG  480
PPEVRITGID FPQPGFRPTQ RIEETGRRLT KYAQEFGVPF KYQVLAASKM ETIRAEDLNL  540
DPEEVLIVNC IYQFKNLMDE SVLIESPRDV ALNNIRKMRP HAFIHGIVNG SFSAPFFVTR  600
FREALFYYSA LFDVLDTTTP RDSNQRMLIE QNIFGRAALN VIACEGTDRV ERPETYKQWQ  660
VRNQRTGLKQ LPLNPNIMQV VRDKVKECYH KDFVIDIDHH WLLQGWKGRI LYAISTWVAN  720
DDAGSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-443507178374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.250041e-172callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLC5YQA70.0C5YQA7_SORBI; Putative uncharacterized protein Sb08g018940
STRINGSb08g018940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-159GRAS family protein