PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG295000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 318aa    MW: 34466.2 Da    PI: 5.1464
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG295000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.8e-14125178457
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                           k+ rr+ +NRe+ArrsR+RK+a +   e  v +L++eN +L k+l  ++++++
  Pavir.3NG295000.1.p 125 TKKMRRMLSNRESARRSRKRKQAHLIDIESQVSKLTSENASLLKRLADMTQKYK 178
                          6999***********************************999966666665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-16122186IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-12123178No hitNo description
PROSITE profilePS5021711.128124176IPR004827Basic-leucine zipper domain
PfamPF001704.2E-12125178IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-11126177No hitNo description
CDDcd147023.74E-17127177No hitNo description
PROSITE patternPS000360129144IPR004827Basic-leucine zipper domain
PfamPF124981.5E-24193298IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MAGAGAGADD DVMEVSCGGG DGRDPGAYAA VLKRRLDLYC AAVAKSMEAK SQEFSLGYRN  60
SQASDTSQLI SQASFDDAGD GGTLVTNSNI IDHEDFRGNP ANSGTSKEQS DDDGDLEENT  120
DPANTKKMRR MLSNRESARR SRKRKQAHLI DIESQVSKLT SENASLLKRL ADMTQKYKDA  180
TLDNRNLTVD VETMRRKVNI AEEAVRRLTG TTLLLSTTCD KTASSMRFSS CPSDAGSASV  240
TIEDSMEHFL QAPLQCDPIK LDHPNAAILL TRREMGTKPD SLQRVASLED LQKRIHRDSI  300
HSETASTFSD PEALANG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138144RRSRKRK
2138145RRSRKRKQ
3140145SRKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.55320.0callus| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3NG295000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805357.10.0light-inducible protein CPRF2-like
TrEMBLA0A2S3HFB10.0A0A2S3HFB1_9POAL; Uncharacterized protein
STRINGPavir.Cb00258.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.24e-28bZIP family protein