PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG203300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 675aa    MW: 75126.6 Da    PI: 5.2739
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG203300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.44.1e-952986671373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cAeavs+g++  a+alL ++++++sp+gd+ qRla++f+++L+ rla+    + +a +p++ts    +++l a++l  +v+ +
  Pavir.3NG203300.1.p 298 LRTLLTHCAEAVSAGNHLSATALLRQIKQRSSPSGDASQRLAHCFAQGLELRLAG----MGAAAKPKRTS---AIDHLRAYQLHLQVCSF 380
                          6789***************************************************....66667777776...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                            +++     aI +av+g ++vHi+D++   G+QWp Ll+aLa+R++gpp++RiTg+  p +g   + +++et++rL++fA++ g+pf+f
  Pavir.3NG203300.1.p 381 RMVAFKFSHMAITRAVAGRKKVHIVDYGEHRGFQWPLLLDALATREGGPPEVRITGITFPYPGfrPAARIKETERRLSDFARQRGIPFRF 470
                          *************************************************************9999************************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                          + +v+ r+e+++ e+L ++p+E+l+Vn  +   +l+de v+  +   +rd vL  + +++P+v++++ ++++ n++ F++rf e+l yys
  Pavir.3NG203300.1.p 471 RSIVSARWETISAEDLVMEPDEVLVVNGLFYFGKLMDEGVDDIDspsPRDMVLGNISKMRPDVFILCVENSSQNAPFFVTRFRETLFYYS 560
                          ************************************998765544559****************************************** PP

                 GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                          a+fd++++++pr+  er+ vE+  +g ++++++a eg++r+ r et+++W+ r ++aG++++pl+ +++   +  +++ + + + ++ ++
  Pavir.3NG203300.1.p 561 AMFDMMDSTAPRDCAERMLVEEI-FGHWAMDAIAYEGSDRVLRPETYKQWQTRSNRAGLRQLPLDPDTVRYLSKRVKEGYHNDFVIDVDQ 649
                          **********************9.************************************************99999999888******* PP

                 GRAS 356 gslvlgWkdrpLvsvSaW 373
                          ++l++gWk+r L ++S W
  Pavir.3NG203300.1.p 650 QWLLQGWKGRILCAMSTW 667
                          ****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.068272648IPR005202Transcription factor GRAS
PfamPF035141.4E-92298667IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MAAASEDLTD PEPFSPSVFL NLSPTTPPPA PSPKNDDLVL PLISRMLMAE DTDDNFLYQR  60
QHPDDTALLQ AQQTFADILS DASSSASTKS SGSASAVPFT FTISPPSSDA PAAFASTTCC  120
WPYDPAELSR LLLSRTHPNM TMPPPADVDE DDGEHDSSCF LSDQNSRVKV NMEMLNQAFL  180
KGMEEASKFL PTTTTNDNNL MQDSCDGRGR GSKKKRHNRG DQDDVDALEA EAGRRSKLTA  240
PEESGEVADG VFLKGYEVSL EKMHGLSISG SRLPVARREE EEERAKSQRS NSNEAVDLRT  300
LLTHCAEAVS AGNHLSATAL LRQIKQRSSP SGDASQRLAH CFAQGLELRL AGMGAAAKPK  360
RTSAIDHLRA YQLHLQVCSF RMVAFKFSHM AITRAVAGRK KVHIVDYGEH RGFQWPLLLD  420
ALATREGGPP EVRITGITFP YPGFRPAARI KETERRLSDF ARQRGIPFRF RSIVSARWET  480
ISAEDLVMEP DEVLVVNGLF YFGKLMDEGV DDIDSPSPRD MVLGNISKMR PDVFILCVEN  540
SSQNAPFFVT RFRETLFYYS AMFDMMDSTA PRDCAERMLV EEIFGHWAMD AIAYEGSDRV  600
LRPETYKQWQ TRSNRAGLRQ LPLDPDTVRY LSKRVKEGYH NDFVIDVDQQ WLLQGWKGRI  660
LCAMSTWVAD DDAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-422986675374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450068.10.0hypothetical protein SORBIDRAFT_05g027783, partial
TrEMBLC5Y8M00.0C5Y8M0_SORBI; Putative uncharacterized protein Sb05g027783 (Fragment)
STRINGSb05g027783.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein